KEGG   Bifidobacterium adolescentis ATCC 15703: BAD_1129Help
Entry
BAD_1129          CDS       T00437                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bad  Bifidobacterium adolescentis ATCC 15703
Pathway
bad00340  Histidine metabolism
bad01100  Metabolic pathways
bad01110  Biosynthesis of secondary metabolites
bad01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BAD_1129 (hisD)
Enzymes [BR:bad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BAD_1129 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: BAF39910
UniProt: A1A2H7
Position
complement(1397861..1399396)
Genome map
AA seq 511 aa AA seqDB search
MASTGIYFSRKSAWHGKRRICVSHNAAECETTGRSRDLALLPWGVMSEENYMRIIDLRGK
KLTRAEMLEAMPRAEMGTNEATELVQPILDDVKARGAAALRDFAEKFDHIRPEHLRVPVE
AMKAAVDELDPEVRAAIEESVRRCRAVSASQVPAPFHTDLAEGARVAERWIPVQRVGLYV
PGGKAVYPSSVIMNVVPAQAAGVESLAIATPPSRSSSDGLPDKTILATCAILGVDEVYAV
GGAQAIAMFAYGAKGSEPQDGEILCDPVDKITGPGNIFVATAKRMVSGIVGIDAVAGPTE
IAIIADKGANPSWLAADLIGQAEHDELAGSVLITDSEDIADKVQESLKYRVPRTEHAERV
NTSLRGRQSGIILTDGIEQSIDAANAYAAEHLEVQTADPDAVIAKIRNAGAIFRGPYSPV
PLGDYMSGSNHVLPTSGTARFAAGLGVHTFMKPVEVIEYDEQGLKTLAARVNAFAVSEDL
PAHGECVLSRFIDDPYNKATIKEQEEQAGLR
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaccggcatatatttttcgcggaaatcggcatggcatggaaaacggcggatc
tgcgtgtctcacaatgcggctgaatgtgagacgacgggacgttctcgtgacttggcgttg
ttaccatggggcgttatgagcgaagaaaactatatgcgaatcattgacctgcgcggcaag
aagctgacccgagctgaaatgctggaagccatgccccgcgccgagatgggcaccaacgag
gccactgagctcgtacagccgattctcgatgatgtgaaggcccgcggcgctgcggccctg
cgcgacttcgcggagaagttcgaccatatccgtcccgagcatctgcgtgtgccggtcgag
gccatgaaggccgccgtcgacgagctcgatccggaagtgcgcgccgccatcgaggaatcc
gtgcgccgctgccgcgccgtatccgcatcccaggtgccggccccgttccacaccgacctg
gccgaaggcgcgcgcgtcgccgaacgttggattccggtgcagcgcgtcggcctgtacgtg
ccgggaggcaaggccgtctacccgagctccgtcatcatgaacgtggtgccggcgcaggcc
gcaggcgtcgaatcgctggccatcgccaccccgccgagccgcagcagctccgacggtctg
ccggacaagaccatcctcgccacctgcgccatcctcggcgtggacgaggtgtacgcggtc
ggcggcgctcaggccatcgccatgttcgcttacggcgccaagggctccgaaccgcaggac
ggcgagatcctgtgcgatccggtggacaagatcaccggcccgggcaacatcttcgtcgcc
accgccaagcgcatggtctccggcatcgtcggcatcgacgccgtcgccggtccgaccgaa
atcgccatcatcgccgacaagggcgccaacccaagctggctcgccgccgatctgatcggc
caggccgaacatgacgagctcgccggctccgtgcttatcaccgacagcgaagacatcgcc
gacaaggtgcaggaaagcctcaagtaccgcgtgcctcgcaccgaacacgccgagcgcgtc
aacacgtcgctgcgcggccgccagtccggcatcatcctcacagacggcatcgaacagtcc
atcgacgcggccaacgcgtacgcggccgaacaccttgaagtgcagaccgctgatccggat
gccgtgatcgccaagatccgcaacgccggcgccatcttccgtggcccgtactccccggtt
ccgctgggcgactacatgtccggttccaaccacgtgctgccgacctccggcaccgcgcgc
ttcgccgccggcctcggcgtgcacaccttcatgaagccggtcgaagtcatcgaatacgac
gagcagggactgaagaccctcgccgcccgtgtgaacgccttcgccgtctccgaagatctg
ccggcacacggcgaatgcgtgctgagccgcttcatcgacgacccgtacaacaaggcgacc
atcaaggaacaggaagagcaggccggcctccgatga

DBGET integrated database retrieval system