KEGG   Bifidobacterium adolescentis: BAD_1208Help
Entry
BAD_1208          CDS       T00437                                 

Definition
glucosylceramidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
bad  Bifidobacterium adolescentis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BAD_1208
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BAD_1208
Enzymes [BR:bad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BAD_1208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1503747..1505090)
Genome map
AA seq 447 aa AA seqDB search
MTTWIATTQDNKLADKSSEIESTHATSASDLQLDGNEYQALRGFGGCFNELGWLPLQTVT
EEERDQIIKELFSPDEMNFTFNRAPVGANDFADHWYSYNETDGDYEMEHFSVEHDERTLI
PYIHRAQEWQPNMQLFSSPWSPPTWMKRPKAYNYGRLVQTPENLKAYAKYFVKYIQAYAE
HGITVNQLHVQNEVFADQKFPSALWDSEALKVFIRDYLGPAFGEAGLDTDIWLGTLNGPE
DMAWTGGYGMKLNNYNRFVDNILFDDGARKYIKGIAYQWAGQNCIARTHESWPEIELIQS
ESECGMGDNTWEYAEYIFHLINHYLRNGATAYTYWNMILDDQDSTWGWWQNSLFTITADT
HEVRRNPEYYVMRHFSHFVKPGAHVLGTTGHFNSMAIAFRNPDGTIVVVAQNALEEERPF
EFADPCNADRGIKVTLAPRSFNTFVLD
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgactacttggatcgcgacaacgcaagacaacaagcttgccgacaaatcatccgaaatt
gaatccacgcatgccacttccgcttccgatctgcagcttgatggcaatgaatatcaggca
ttgcgtggcttcggcggctgcttcaacgagcttggctggcttcctctgcagacggttact
gaagaggaacgtgatcagatcatcaaggaactgttcagcccggatgagatgaacttcacc
ttcaatcgtgcgccggtcggtgccaatgatttcgccgatcattggtatagctataacgag
accgacggcgattatgagatggagcatttctccgtcgagcatgatgagcggacgctgatt
ccgtatattcatcgcgcgcaggaatggcagccgaacatgcaactgttctccagcccgtgg
agcccgccgacatggatgaagcgtccgaaggcttataactatggtcgtttggtgcagact
cctgagaatcttaaggcatatgcgaagtatttcgtcaagtacattcaagcttatgccgag
catggcattaccgtgaatcagctgcatgtgcagaatgaggtgtttgccgatcagaagttc
ccgagtgcattgtgggattccgaagcgctcaaggtgttcatccgcgattatcttggacct
gcttttggcgaagctggtcttgacaccgatatttggctgggtacgctgaatggtccggaa
gatatggcgtggaccggcggctacggcatgaagctgaataattacaaccgttttgtcgac
aatattctgttcgacgatggcgctcgcaagtacatcaagggcatcgcttaccagtgggcc
ggccagaactgtattgcgcgtacgcatgaatcctggcctgaaatcgagctgattcagtct
gaatccgaatgcggtatgggtgataatacgtgggaatatgcggagtatattttccacttg
atcaaccattatttgcgtaatggcgcgactgcttacacttattggaatatgattcttgac
gatcaggattctacgtgggggtggtggcagaattcactgttcaccattactgcggatacg
catgaggttcgccgtaatccggaatattatgtgatgcgtcatttctcgcatttcgtcaag
ccgggtgcgcatgtgcttggcactacgggtcatttcaattcgatggctattgcgttccgt
aatccggatggcaccattgtggtggtggcccagaacgctctcgaagaggagcgtccgttt
gaatttgccgatccttgcaatgccgatcgcggtatcaaggtgacgcttgctccgcgttcg
ttcaacacgtttgtgctggactga

DBGET integrated database retrieval system