KEGG   Bifidobacterium adolescentis: BAD_1211Help
Entry
BAD_1211          CDS       T00437                                 

Gene name
bga
Definition
beta-galactosidase I
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bad  Bifidobacterium adolescentis
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bad00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1507816..1509882)
Genome map
AA seq 688 aa AA seqDB search
MMKGIDRIDEDMKMMKDAGLNVIRIAESTWSTCEPQPGVFDFTYVDRALDAAQRAGIDVI
VGTPTYAVPSWLVKLDPSVLAVTPNGQGKYGARQIMDIVNATYRFYGERVIRKLISHVAD
HPAVIGYQVDNETKYYDSVSEDMQRLFVKYLREKFHGDLNELNHHFGLDYWSNRIDSWED
FPDVTATINESLGGEFDKFRRDQVRAFLQWQADIVREYAHDDQFITHNFDFEWRGYSYGV
QPAVDHFKAATAVDITGVDIYHPTEDDLTGKEIAFGGDMTRSTKNGQNYLVLETEAQGQH
GWVPFPGQLRLQAYSHLASGADMVEYWHWHSIHNSFETYWKGLLSHDLEPNPTYREAGVF
GREIAKPEVGERLVHLKKHNKVAIMVSNESLTALDWFLIEAGFPFGGTLKYNDVVRNVYD
ALFELNVECDFIPSDAPAERLASYEMIVTPALYCAPQETTDRLREFVSNGGHLVSTMRSF
VTDDEVTVWHDRAPHNLTDVFGMTYNQFTRPNGHVSVEFAGALAETASTDAQSLIELLNA
DADTEVLASYGHYAWKDYAAVTRHAFGKGDAEWVATLLDADSIRAVMREAVEHAGVEGAG
TALAGQVAVRQGVNALGENVTYLLNYSADEVTVASPIAGEVVVAPVVIATDGSIDEVANA
EVVLKEGAAVKQGDPLTIGRWNVAVIAG
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaggcatcgaccgcatcgatgaggatatgaaaatgatgaaggacgcggggctg
aacgtcatccgcatcgccgaatccacgtggagcacctgcgaaccgcaaccgggtgtattc
gacttcacctatgtggaccgtgcgctcgacgccgcgcagcgtgccggcatcgatgtcatc
gtcggcacgccgacctacgcggtgcccagctggctcgtcaagctcgacccgagcgtgctc
gcggtcacgccgaacggacagggcaagtatggcgcgcgccagatcatggacatcgtcaac
gccacctaccgcttctacggcgaacgtgtgatccgcaagctcatctcccacgtcgccgac
catccggccgtcatcggctaccaggtggacaacgagacgaaatactacgattccgtctcc
gaggacatgcagcgcctgttcgtcaagtatctgcgcgagaagttccacggcgatctgaac
gagctcaaccaccacttcggcctcgactactggtccaaccgcatcgactcctgggaggac
ttcccggacgtgaccgccaccatcaacgagtccctgggcggcgaattcgacaagttccgc
cgcgatcaggtgcgcgccttcctgcagtggcaggccgacatcgtgcgcgaatacgcgcat
gacgaccagttcatcacccacaacttcgatttcgaatggcgcggatactcctacggcgtg
cagccggccgtcgaccacttcaaggccgcgaccgcggtggacatcaccggcgtggacatc
taccacccgaccgaagacgacctgaccggcaaggagatcgccttcggcggcgacatgacc
cgctccaccaagaacggccagaactacctggtgctcgaaaccgaggcccaaggccagcac
ggctgggtgccattccccggccagctgcgcctgcaggcctactcccatctcgcctccggc
gccgacatggtggaatactggcactggcactccatccataattcctttgaaacatattgg
aagggcctgctgagccacgacctcgaaccgaaccccacgtaccgcgaagccggcgtattc
ggtcgcgagattgccaaaccggaagtgggggagcggctcgtccacctgaagaagcacaac
aaggtagctatcatggtcagcaacgaatcgctgaccgcgctcgactggttcctcatcgaa
gccggcttcccattcggcggcaccctcaaatacaacgacgtggtgcgcaatgtctacgac
gcgctgttcgagctcaacgtggaatgcgatttcatcccctccgacgctcccgccgagcgt
ttggcctcatacgagatgattgtgaccccggcgctgtactgtgctccgcaggaaacgacc
gatcgcctgcgtgaattcgtctccaacggcggacacctcgtctccaccatgcgctccttc
gtgaccgacgacgaggtgaccgtatggcacgaccgcgcgccgcacaatctcaccgacgtg
ttcggcatgacgtacaaccagttcacccgcccaaacggccacgtttccgtggaattcgca
ggtgcgctcgccgaaaccgcgtccaccgatgctcagtcgctgatcgaactgttgaacgcc
gacgccgatactgaggtgctcgcatcttatggacactacgcttggaaggattacgccgca
gtcacccgtcacgcattcggcaagggcgatgccgagtgggtcgccacactgcttgacgcc
gattccattcgtgcggttatgcgagaggctgtggagcatgccggcgtcgagggcgctgga
accgcgctcgcgggacaggtcgcggttcgccagggtgtgaatgccctcggcgagaacgtg
acgtatttgctcaactattccgccgacgaagttactgttgcaagcccgattgcgggtgaa
gtagtggtcgctccggtcgtcatcgccaccgacggcagtattgatgaggttgcaaatgct
gaagtcgtgctgaaggaaggtgcagccgttaagcagggtgatccgttgacgattggccgc
tggaatgttgcggtgatcgccggctga

DBGET integrated database retrieval system