KEGG   Bifidobacterium adolescentis: BAD_1401Help
Entry
BAD_1401          CDS       T00437                                 

Gene name
bgaB
Definition
beta-galactosidase I
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bad  Bifidobacterium adolescentis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BAD_1401 (bgaB)
Enzymes [BR:bad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BAD_1401 (bgaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1764134..1766269)
Genome map
AA seq 711 aa AA seqDB search
MALCQLPKEIIVSARRNFEWPELLTADGRGIAFGGDYNPDQWSEDIWDDDIRLMKQAGVN
TVALAIFSWDRIQPTEDRWDFGWLDRIIDKLGNAGIVVDLASATATAPLWLYESHPEVLP
RDKYGHPVNAGSRQSWSPTSPVFKEYALTLCRKLAERYGTNPYVTAWHMGNEYGWNNRED
YSDNALEAFRAWCRRKYGTIDALNQAWGTTFWGQEMNGFDEVLIPRFMGADSMVNPGQKL
DFERFGNDMLLDFYKAERDAIAEICPDKPFTTNFMVSTDQCCMDYAAWAKEVNFVSNDHY
FHEGESHLDELACSDALMDSLALGKPWYVMEHSTSAVQWKPLNTRKRKGETVRDSLAHVA
MGADAINFFQWRASAFGAEAFHSAMVPHAGEDTKLFRQVCELGASLHTLADAGVQGTELA
HSDTAILFSAESEWATRSQTLPSMKLNHWHDVRDWYRAFLDAGSRADIVPLAYDWSSYKT
VVLPTVLILSAADTQRLADFAAAGGRVVVGYATGLIDEHFHTWLGGYPGAGDGLLRSMLG
VRGEEFNILGAEAEGEPGEIRLSSADDSAALDGTTTRLWQNDVNVTGEHAQVLATYAGEE
ADEWELDGTAAVTRNPYGSGEAYFVGCDLDVADLTKLVRAYLAASSQENADVLHTVRASA
DATFDFYLPRGKKTVELQGIEGEPVILFQTDREEKPGSYTVRRNGVLVVRR
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atggctttatgccaattaccaaaggagataatcgtgagtgcgcgacgcaacttcgaatgg
ccggaactgctgaccgcggatggccgcggcatcgccttcggtggcgactacaatcccgac
caatggtccgaggacatctgggacgacgacatccgcctgatgaagcaggccggcgtcaac
accgtggccctcgccatcttcagctgggatcgcatccaacccaccgaggatcgttgggat
ttcggctggctcgaccgcatcatcgacaaactcggcaatgccggcatcgtggtcgacctg
gcctccgcgacggcgaccgcgccgctgtggctgtacgaaagccacccggaggtccttccg
cgtgacaagtacggccatccggtcaacgccggctcgcgccaatcctggagcccgaccagc
ccggtgttcaaggaatacgcgctgaccctgtgccgcaagctcgccgaacggtacggcacc
aacccgtatgtgaccgcatggcacatgggcaacgaatacgggtggaacaaccgcgaggac
tactccgacaacgcgctcgaggccttccgcgcatggtgccgccgcaagtacggcaccatc
gacgcgctcaatcaggcgtggggcaccaccttctggggccaggagatgaacggcttcgac
gaagtgctcatcccacggttcatgggcgccgactcgatggtcaaccccggccagaagctc
gacttcgaacggttcggcaacgacatgctcctcgacttctacaaagccgaacgcgacgcg
atcgccgaaatctgccccgacaagccgttcaccacgaacttcatggtctccaccgaccag
tgctgcatggactacgccgcctgggccaaggaagtgaacttcgtatccaacgaccactac
ttccacgagggcgaatcccacctcgacgagctggcctgctccgacgctctcatggattcg
ctcgcgctcggcaagccgtggtatgtcatggaacactccacctcggcggtgcagtggaag
ccgcttaacacccgcaagcgcaagggcgagaccgtgcgtgactccctggcccatgtggcc
atgggcgccgacgccatcaacttcttccagtggcgcgcgtccgcgttcggtgccgaagcg
ttccattcggccatggttccgcacgccggcgaggacacgaagctgttccgccaggtgtgc
gagctgggcgcgtcgttgcacacgctcgccgacgccggcgtgcagggcaccgaattggcg
cactccgacacggcgatcctcttcagcgccgaatcggaatgggccacccgctcccagacc
ctgccgagcatgaaactcaaccactggcatgacgtgcgtgactggtaccgcgcgttcctg
gacgcgggctcgcgcgccgacatcgtgccgctcgcctacgactggagctcgtacaagacc
gtcgtgctgccgaccgtgctgatcctgagcgccgccgacacgcagcggttggccgacttc
gcggccgccggcggccgcgtggtggtcggctacgcgaccggactgatcgacgagcatttc
cacacttggctcggcggatacccgggcgcgggcgatggcctgttgcgctcgatgctgggc
gtccgcggcgaggaattcaacatcctcggcgccgaagccgaaggcgagccgggcgagatc
cgactgtcgtccgccgacgattcggccgcgctggacggcaccacgacccgcctgtggcag
aacgacgtgaacgtgaccggcgaacacgcgcaggtgcttgccacgtacgccggcgaggaa
gcggacgaatgggagctcgacggcacggccgcggtcacccgtaatccgtacggctccggc
gaagcgtatttcgtcggctgcgacctggatgtggccgatctgacgaagctggtccgcgca
tatctcgcggcctcgtcgcaggagaatgccgacgtgctgcacaccgtgcgcgcctccgcc
gacgccaccttcgacttctacctgccccgtggcaagaagacggtcgaattgcaaggcatc
gaaggcgagccggtcatcctgttccagacggatcgggaggaaaagcccggctcgtacacc
gtgcgccgcaacggcgtgctcgtggtaaggcggtaa

DBGET integrated database retrieval system