KEGG   Bifidobacterium adolescentis ATCC 15703: BAD_1485Help
Entry
BAD_1485          CDS       T00437                                 

Gene name
rbsK
Definition
PfkB family sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bad  Bifidobacterium adolescentis ATCC 15703
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BAD_1485 (rbsK)
Enzymes [BR:bad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BAD_1485 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1868588..1869580)
Genome map
AA seq 330 aa AA seqDB search
MSAAEILSALDRIHGTVSVIGSMNADYTVTAQRLPGPGETITGGPLQLLPGGKSGNQAAA
AARIGATVQMFGAVGSDNNADFLLGALGEAGVNTTHVRRVLGPSGTTVITVDAHGENTIV
YSPGSNAQVTVDYVESVRDALTHSTVLGLCLESPIETVTAAARMCHEAGVKVLLNDSPFT
PSLPAELIEASDILLVNEHEMAQLLGIDEPENDDWDSFDWWHALDELRGFGFEQAIVTLG
GDGSVVLDGTADDPEHRVQRIAPVRVKAVDTTGCGDSFMGTVLAGLSSGLALSESAELAS
YVSAYAATGYGAQASYGNAAQIREAFASAE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagcagaaatcctctccgcactggaccgcatccacggcaccgtttccgtgatc
ggttccatgaacgcggactacaccgtcaccgcacagcgactgcccgggccgggcgagacc
atcaccggcggcccgctacagctgctgcccggcggcaaatccggcaaccaggccgcggcg
gccgcacgcatcggcgccaccgtgcagatgttcggcgcggtcggctccgacaacaacgcc
gacttcctgctcggagcgctcggcgaagcgggcgtcaacaccacgcacgtgcgccgcgtg
ctcggcccgtccggcaccaccgtcatcaccgtggacgcgcacggcgagaacaccatcgtg
tactcgcccggctccaacgcgcaggtgaccgtcgactacgtcgaatccgtgcgtgacgcg
ctgacccactccacagtgctcggcctgtgcctggaaagccccatcgaaaccgtcaccgcg
gccgcacgcatgtgccacgaagcgggcgtgaaggtgctgctcaacgactcgccgttcacc
ccgtccctgccggcggaactgatcgaagcatccgacatcctgctcgtcaacgagcatgaa
atggcgcaactgctcggcatcgacgagccggagaacgacgattgggattcgttcgactgg
tggcacgcgctcgacgaactgcgcggattcggcttcgaacaggcgatcgtgacgcttggc
ggcgacggttccgtggtactcgacggcaccgcggacgatccggaacaccgtgtccagcgc
atcgccccggtacgcgtcaaggccgtcgacaccaccggctgcggcgattccttcatgggc
accgtgctggccggtctgtcgtccggactggcgctgtccgaatccgccgaactcgcctcg
tacgtttcggcgtacgcggccaccggctacggcgcgcaggcgtcctacggcaacgcggcg
cagatccgcgaagcgttcgcgtccgccgaatag

DBGET integrated database retrieval system