KEGG   Bifidobacterium adolescentis: BAD_1508Help
Entry
BAD_1508          CDS       T00437                                 

Gene name
rmlCD
Definition
fused dTDP-4-keto-L-rhamnose reductase/dTDP-4-keto-6-deoxyglucose-3,5-epimerase
Orthology
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bad  Bifidobacterium adolescentis
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BAD_1508 (rmlCD)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BAD_1508 (rmlCD)
Enzymes [BR:bad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.133  dTDP-4-dehydrorhamnose reductase
     BAD_1508 (rmlCD)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BAD_1508 (rmlCD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1894737..1896167
Genome map
AA seq 476 aa AA seqDB search
MDFMDFEKDLRAVETNIPGLVVFDLPVHGDNRGWFKENWQRAKQTKLGLPDFGPVQNNIS
YNAKKGVTRGIHAEPWDKYISIAAGSVFGAWVDLRPGESFGQVYTTVLDPSKAIYVPRGV
GNSFQALEDGTVYTYLVNAHWSLEQKKTYTFVNLADPDLHIDWPIPLEDSERSEADLHHP
MLKDAKPMAPKKTLVLGSKGKLGRAIREYAESHSLENFEYHDADTFDISDTASYENIDWD
LYGTIINAAAYTSVDGAETPEGRKAAWTINVRGVRNLAKIATEHRITLVHISSDYVFDGT
LQFHKEDENFAPLSVYGQTKAAGDALVENVPQHYLIRSSWIIGEGRNFVTRMLDLAQSGA
TAEAPNDQFGRLTFTDDMAGAIFHLLNSNAPYGTYNMTGSGRVVSWFDLAQIIFAAANAD
NSKIIANSVEEYAKENNAALRPHNCSLDLSKIEDAGYQPADWETSLHDYLAKELNK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggatttcatggatttcgaaaaggacctgagggccgtggagacgaacattcccggactg
gtcgtgttcgacctgccggtgcatggcgacaaccgcggctggttcaaggagaactggcag
cgcgcgaagcagacaaaactgggcctgcccgatttcgggccggtgcagaacaacatcagc
tacaacgcgaagaagggcgtgacgcgtggcatccacgcggagccgtgggacaaatacatc
agcatcgcggccggcagcgtgttcggcgcgtgggtggacctgcgtccgggcgagagcttc
ggccaggtgtacacgacggttttggatccgtcgaaggcgatttacgtgccgcgtggcgtg
ggcaacagcttccaagcgttggaggacggtaccgtgtacacgtacctcgtgaacgcgcac
tggagcctggagcagaagaagacgtacacgttcgtgaacctcgccgacccggacctgcat
atcgactggccgatcccgctggaggactccgaacgatccgaggcggacctgcaccatccc
atgctgaaggatgcgaagccgatggccccaaaaaagactttggtgcttggcagcaaaggc
aaattgggacgtgcaattcgtgaatacgctgaaagccattcattggagaatttcgaatat
cacgatgccgatacctttgatatctcggacaccgcctcttatgagaatatcgattgggat
ttatatggcaccattatcaatgcggcagcctatacttccgtcgatggggcagaaacgcct
gaaggtcgcaaagctgcttggactataaacgttcgcggtgttaggaaccttgcgaagatt
gccacagaacacagaatcactttggtgcatatttccagtgactatgtatttgatggcact
ctccaattccacaaggaagatgagaatttcgcgccactaagcgtttatggccaaactaaa
gccgctggcgatgcattagtagagaacgttccccagcattatctgattcgttctagctgg
attattggagaaggtcgtaatttcgtaacccgaatgctggatcttgctcaatctggagct
acggcagaagctccgaacgatcagttcggtcgactgacttttacggatgacatggctgga
gcaattttccatcttctgaatagcaacgccccttacggcacctataacatgacaggctcg
ggacgtgtcgtgagctggtttgatcttgctcaaattatttttgctgcagcaaatgccgac
aattcaaagattattgcaaattccgtcgaagaatatgccaaggagaataacgcagctttg
cgtccgcataattgttcgcttgatttgagcaaaatcgaagatgccggttatcagcccgcc
gactgggagacatctcttcatgactatcttgcaaaggaactcaacaaatga

DBGET integrated database retrieval system