KEGG   Bifidobacterium adolescentis: BAD_1528Help
Entry
BAD_1528          CDS       T00437                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bad  Bifidobacterium adolescentis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bad00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bad00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bad00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1929698..1932109)
Genome map
AA seq 803 aa AA seqDB search
MIRRYLNTVEESKMISGAGAMNPVCPREDGRLEWGNGVVSMLFDTAGDSPVRLCNVAGRG
MGPIGGRVTDDGRTVLERDPRPIVEVRAANTGSQDNRLTLIATVAGSVLRFVSAAASEPE
EGSAEPYRLEIVQFASYAELEPHGRAFEPTAAERAEAAAQPSPETVRHADATAGLVVTSV
FEAFPGLSAVRTYTRLSSARPLPIEAVSSLNLTVPMRVNCGKIDHSRVFWGDSAWAVEND
WRSRPLRDVSVRNRNQVINPGQSSSRFAMSSASTWSTGVHEPAGIVQVEGSRRQSRDFSV
MWQIEHNGPWEWEIGEDDPGLHISAFGPEYQDHHWYTELGEGHDFESVPVSFAISAGDWQ
QSVAEMTLQRRALRAAKARELGRSEQFERTQGLVIYNDYMNTLFGDPRLEKELPLVEGAA
RVGADIFCIDAGWYDSTDGGWWDMVGEWQASTNRFGEAGLKGLADTIRAHGMGLGLWLEP
EVIGVKSPLAQSLPDDAFFQRHGVRVCDSGRYLLDFRSPAAREHVTRTVNRLIDDFGAVF
FKFDYNTVPGVGTDLDAESAGAGLLGHCRAYLDWLDDLRRRHPDVMIENCGSGAMRADYA
QLQRLDLQSTSDQCDPLIYAAIAAGAGLTILPEQQGNWGYAQQEMDDETAVFTLATGILG
RLYLSGFIDRMDEHRLALVRDAVALHRRVLTEQQELVPFWPARLPDFDGDWLVVGLRHPS
FLPSEDDDSCDYIIVWRRGGTPSVNVPLSEDCHIEQIFPNPAVPEHAPDAKPWTVERMDP
ETVRLNAATSKQPSARIFAIRRA
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggcggtatctgaacacggttgaggagtcgaagatgataagcggtgccggtgca
atgaaccccgtatgtccccgtgaggacgggcgtctcgaatggggcaatggcgtggtttcc
atgctgttcgacacggcaggcgattcccccgtccgattgtgcaacgttgcaggccgcggc
atggggcccatcggcggccgtgttaccgacgatggaagaaccgtgctggaacgtgatccg
cgtccaatcgtcgaagtgcgtgccgccaacaccggatcgcaggacaatcgcctcaccttg
atcgccacggtggcgggcagcgtattgcgattcgtctcggccgccgcttccgagccggag
gaagggtccgccgaaccatatcgtttggagatcgtccaattcgcttcgtatgcggaactg
gagccgcacgggcgcgcgttcgaaccgaccgccgccgaacgggccgaagccgccgcgcag
ccctcgccggaaaccgtccgccatgccgacgccacggctgggctggtagtcacttccgta
ttcgaagcgttcccgggtctgtccgcagtgcgcacttacacgcggttgagctccgcgcgc
ccgctgcccatcgaggcggtgtcgtcgttgaatctgacggtgccgatgcgcgtcaactgc
ggcaaaatcgaccattcccgcgtattctggggagactccgcgtgggcggtggaaaacgat
tggcgcagccgtccactgcgcgacgtgtcggtgcgcaatcgcaatcaagtcatcaatccc
ggccagtccagctcgcgattcgccatgagctccgcctccacatggagcaccggcgtgcat
gagccggccggcatcgtgcaggtggagggttcgcgccgccaatcgcgcgacttctccgtg
atgtggcagatcgagcacaacggcccatgggaatgggagatcggcgaggatgatcccggt
ttgcacatcagcgcgttcggaccggaatatcaggaccaccattggtatacggagctgggt
gaaggccacgatttcgaatcggtgccggtctccttcgcgatctcggccggcgattggcag
cagtccgtcgccgaaatgacattgcagcgccgtgcgttgcgtgccgccaaggctcgcgaa
ttgggtcgttccgagcagttcgaacgcacgcagggactcgtcatctacaacgattacatg
aacaccctgttcggcgacccgcgcttggagaaggagctgccgctcgtcgagggcgcggca
cgcgtcggcgcggacatcttctgcatcgacgccggctggtacgacagcacggacggcggt
tggtgggacatggtcggagaatggcaggcctccacgaaccgtttcggcgaagctggactc
aagggtttggccgacaccatccgcgcgcatggcatgggcttgggattgtggctcgagcct
gaggtgattggcgtgaaatcgccgctcgcccaaagtctgcccgatgacgcgttcttccag
cgtcacggtgtgcgcgtctgcgattcgggccggtacctgcttgacttccgctcgcccgcc
gcacgcgagcacgtcactcgcaccgtcaaccggctgattgacgatttcggcgcggtcttc
ttcaaattcgactacaacaccgtccccggcgtcggcactgatctcgacgccgaatccgcc
ggcgctggcctgctcggccattgccgcgcctatcttgactggctcgacgacctgcgccgc
cgccatccggacgttatgattgaaaactgcggttccggtgcgatgcgcgccgattacgcg
cagttgcaacgattggacctgcaatccacctccgaccagtgtgatccgctgatttacgcc
gcgatcgccgccggcgccggactgacgattctgccggaacagcaaggcaactggggttac
gcccagcaggagatggacgatgagaccgccgtcttcacgctggccacgggcatactcggc
aggttgtacctgtccggattcattgaccgcatggacgagcatcggcttgccttggtgcgg
gatgcggtggccttgcaccgccgtgtgctgaccgagcagcaggaattggtgccgttctgg
ccggcccgtctgcctgatttcgatggcgattggctcgtcgtcggtctgcgccatccgtca
ttcctcccgtcggaggacgacgattcgtgcgattacatcattgtctggcgtcgcggcggc
acgccttccgtgaacgtgccgctgtccgaggactgccatatcgagcagatcttcccgaat
ccggccgttcccgagcatgcgcccgacgccaagccgtggaccgtcgagcgcatggacccc
gagacggtccggctcaacgcggccacctccaagcagccgtccgcccgcatcttcgccatc
cgccgcgcctga

DBGET integrated database retrieval system