KEGG   Bifidobacterium adolescentis ATCC 15703: BAD_1528Help
Entry
BAD_1528          CDS       T00437                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bad  Bifidobacterium adolescentis ATCC 15703
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BAD_1528
  Lipid metabolism
   00561 Glycerolipid metabolism
    BAD_1528
   00600 Sphingolipid metabolism
    BAD_1528
Enzymes [BR:bad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BAD_1528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1929698..1932109)
Genome map
AA seq 803 aa AA seqDB search
MIRRYLNTVEESKMISGAGAMNPVCPREDGRLEWGNGVVSMLFDTAGDSPVRLCNVAGRG
MGPIGGRVTDDGRTVLERDPRPIVEVRAANTGSQDNRLTLIATVAGSVLRFVSAAASEPE
EGSAEPYRLEIVQFASYAELEPHGRAFEPTAAERAEAAAQPSPETVRHADATAGLVVTSV
FEAFPGLSAVRTYTRLSSARPLPIEAVSSLNLTVPMRVNCGKIDHSRVFWGDSAWAVEND
WRSRPLRDVSVRNRNQVINPGQSSSRFAMSSASTWSTGVHEPAGIVQVEGSRRQSRDFSV
MWQIEHNGPWEWEIGEDDPGLHISAFGPEYQDHHWYTELGEGHDFESVPVSFAISAGDWQ
QSVAEMTLQRRALRAAKARELGRSEQFERTQGLVIYNDYMNTLFGDPRLEKELPLVEGAA
RVGADIFCIDAGWYDSTDGGWWDMVGEWQASTNRFGEAGLKGLADTIRAHGMGLGLWLEP
EVIGVKSPLAQSLPDDAFFQRHGVRVCDSGRYLLDFRSPAAREHVTRTVNRLIDDFGAVF
FKFDYNTVPGVGTDLDAESAGAGLLGHCRAYLDWLDDLRRRHPDVMIENCGSGAMRADYA
QLQRLDLQSTSDQCDPLIYAAIAAGAGLTILPEQQGNWGYAQQEMDDETAVFTLATGILG
RLYLSGFIDRMDEHRLALVRDAVALHRRVLTEQQELVPFWPARLPDFDGDWLVVGLRHPS
FLPSEDDDSCDYIIVWRRGGTPSVNVPLSEDCHIEQIFPNPAVPEHAPDAKPWTVERMDP
ETVRLNAATSKQPSARIFAIRRA
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggcggtatctgaacacggttgaggagtcgaagatgataagcggtgccggtgca
atgaaccccgtatgtccccgtgaggacgggcgtctcgaatggggcaatggcgtggtttcc
atgctgttcgacacggcaggcgattcccccgtccgattgtgcaacgttgcaggccgcggc
atggggcccatcggcggccgtgttaccgacgatggaagaaccgtgctggaacgtgatccg
cgtccaatcgtcgaagtgcgtgccgccaacaccggatcgcaggacaatcgcctcaccttg
atcgccacggtggcgggcagcgtattgcgattcgtctcggccgccgcttccgagccggag
gaagggtccgccgaaccatatcgtttggagatcgtccaattcgcttcgtatgcggaactg
gagccgcacgggcgcgcgttcgaaccgaccgccgccgaacgggccgaagccgccgcgcag
ccctcgccggaaaccgtccgccatgccgacgccacggctgggctggtagtcacttccgta
ttcgaagcgttcccgggtctgtccgcagtgcgcacttacacgcggttgagctccgcgcgc
ccgctgcccatcgaggcggtgtcgtcgttgaatctgacggtgccgatgcgcgtcaactgc
ggcaaaatcgaccattcccgcgtattctggggagactccgcgtgggcggtggaaaacgat
tggcgcagccgtccactgcgcgacgtgtcggtgcgcaatcgcaatcaagtcatcaatccc
ggccagtccagctcgcgattcgccatgagctccgcctccacatggagcaccggcgtgcat
gagccggccggcatcgtgcaggtggagggttcgcgccgccaatcgcgcgacttctccgtg
atgtggcagatcgagcacaacggcccatgggaatgggagatcggcgaggatgatcccggt
ttgcacatcagcgcgttcggaccggaatatcaggaccaccattggtatacggagctgggt
gaaggccacgatttcgaatcggtgccggtctccttcgcgatctcggccggcgattggcag
cagtccgtcgccgaaatgacattgcagcgccgtgcgttgcgtgccgccaaggctcgcgaa
ttgggtcgttccgagcagttcgaacgcacgcagggactcgtcatctacaacgattacatg
aacaccctgttcggcgacccgcgcttggagaaggagctgccgctcgtcgagggcgcggca
cgcgtcggcgcggacatcttctgcatcgacgccggctggtacgacagcacggacggcggt
tggtgggacatggtcggagaatggcaggcctccacgaaccgtttcggcgaagctggactc
aagggtttggccgacaccatccgcgcgcatggcatgggcttgggattgtggctcgagcct
gaggtgattggcgtgaaatcgccgctcgcccaaagtctgcccgatgacgcgttcttccag
cgtcacggtgtgcgcgtctgcgattcgggccggtacctgcttgacttccgctcgcccgcc
gcacgcgagcacgtcactcgcaccgtcaaccggctgattgacgatttcggcgcggtcttc
ttcaaattcgactacaacaccgtccccggcgtcggcactgatctcgacgccgaatccgcc
ggcgctggcctgctcggccattgccgcgcctatcttgactggctcgacgacctgcgccgc
cgccatccggacgttatgattgaaaactgcggttccggtgcgatgcgcgccgattacgcg
cagttgcaacgattggacctgcaatccacctccgaccagtgtgatccgctgatttacgcc
gcgatcgccgccggcgccggactgacgattctgccggaacagcaaggcaactggggttac
gcccagcaggagatggacgatgagaccgccgtcttcacgctggccacgggcatactcggc
aggttgtacctgtccggattcattgaccgcatggacgagcatcggcttgccttggtgcgg
gatgcggtggccttgcaccgccgtgtgctgaccgagcagcaggaattggtgccgttctgg
ccggcccgtctgcctgatttcgatggcgattggctcgtcgtcggtctgcgccatccgtca
ttcctcccgtcggaggacgacgattcgtgcgattacatcattgtctggcgtcgcggcggc
acgccttccgtgaacgtgccgctgtccgaggactgccatatcgagcagatcttcccgaat
ccggccgttcccgagcatgcgcccgacgccaagccgtggaccgtcgagcgcatggacccc
gagacggtccggctcaacgcggccacctccaagcagccgtccgcccgcatcttcgccatc
cgccgcgcctga

DBGET integrated database retrieval system