KEGG   Bifidobacterium adolescentis: BAD_1548Help
Entry
BAD_1548          CDS       T00437                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bad  Bifidobacterium adolescentis
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BAD_1548
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BAD_1548
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BAD_1548
Enzymes [BR:bad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BAD_1548
Exosome [BR:bad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAD_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1958069..1960168)
Genome map
AA seq 699 aa AA seqDB search
MSKHKALTGAIAALASVATLGALAAPALAADTTYSPNGKSVAELAQHGGAQRIAAIGNKN
AKNVVLFIGDGMGDSEITVARDYLKGANGHFDGLDAVGQPGALGDVQAGTGQYTTFSVGN
GSKDSAVGKDGDGKLVANPNPGKLTPVTDSSASGSAWATGTKTYNNAVDVDIYGNPQLNL
FELAKAAGKATGNVTTAEIQDATPAVLESHSSERACYGPQGKTDGTSNNASKQCLINQLK
ENGGIGSISEQLLDTRADVTIGGGSKYFRQTVQGGEYKGKTVWEQAKEMGFQTVENDPAA
MNALQYKDGQPVLALMSDGNMPTKFNPSKATAKDPAKDANPTVCTPNADWLGNQGSSLKD
MTKKALDLLNDNPNGQKNGFFLQVEGASIDKQDHAGNACGQIGETDDFDRAIAYAMQNVD
LTNTLVIVTADHAHTSQILNAQPAYALSTVLKTADGNNMVVSYGTAQDDSRDADGGYNGG
DMEHTGTQLRIAASGPGAQRVIGLTDQTDNFYTIAGALGLATSAESQKALSDNGTVKVSA
ADGKFTADVDGFNGDAVLSYELKDKNGKTVAASDSSTPLSGVRVKTAQTTPIALDGVTEG
SEYTLTVTGRQSGKAVTVDFQAPAANSADKNNGKPGAGNADKNGVIASGKVNNDTKAGPF
GAALLGKTGTAVLAAAVAIAMLVAVAMLIKTVKAAKNDR
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcacaaggctctcacgggcgcaatcgcggccctcgcctccgtcgcaacgctc
ggtgcgcttgccgcgccggcgctcgcagccgacaccacgtacagccccaacggcaagtcc
gttgcggaactggcgcagcacggcggcgcgcaacgcatcgcagccatcggcaacaaaaac
gccaagaacgtggtgctgttcatcggcgacggcatgggcgattcggaaatcaccgtcgcc
cgcgactacctgaagggcgccaacggccacttcgacggtctcgacgcggtcggccagccc
ggcgcgctcggcgacgtgcaggccggcaccggtcagtacacgaccttctccgtcggcaac
ggcagcaaggacagcgccgtcggcaaggatggcgacggcaagctggtcgccaaccccaat
ccgggcaagcttacccccgtaaccgattcctccgcatccggttccgcatgggccaccggc
accaagacctacaacaacgccgttgacgttgatatttacggcaatccgcagctgaacctc
ttcgagctggccaaggcggccggcaaagccaccggcaatgtgaccaccgccgaaatccag
gatgccaccccggccgtgctggaatcgcattcgtccgaacgtgcctgctacggcccacag
ggcaagaccgacggcacgtccaacaatgcctccaagcagtgcctcatcaaccagcttaag
gaaaacggcggcatcggctccatctccgagcagctgctcgacacccgcgccgacgtaacc
atcggcggtggttccaagtacttccgtcagaccgtgcagggtggtgaatacaagggcaag
accgtgtgggaacaggccaaggaaatgggcttccagaccgtcgagaacgatccggccgcg
atgaacgccctgcagtacaaggacggccagccagtgctcgccctgatgagcgacggtaac
atgccgaccaagttcaacccgtccaaggccaccgccaaggatccagccaaggacgccaac
ccgaccgtgtgcaccccgaacgccgactggctcggcaatcagggctcctcgctcaaggac
atgaccaagaaggcgctcgatttgctgaatgacaacccgaacggccagaagaacggcttc
ttcctgcaggtcgagggcgcctcgatcgataagcaggaccacgcaggcaatgcctgcggc
cagatcggcgagaccgacgacttcgaccgggccattgcctacgccatgcagaacgtggac
ctcacgaacacgctggtgatcgtcaccgccgaccacgcgcacacctcccagatcctcaac
gcccagccggcttacgcactgtccaccgtgctgaagaccgctgatggcaacaacatggtc
gtctcctacggcaccgcccaggacgattctcgcgatgcagacggcggctacaacggcggc
gacatggagcacaccggcacccagctgcgtatcgcggcttccggccctggcgcacagcgc
gtcatcggcctgaccgaccagaccgacaacttctacacgatcgccggcgctctgggactg
gccacttccgccgaatcgcagaaggcactgtctgacaacggcactgtgaaggtctccgct
gccgacggcaagttcaccgcggacgtcgacggcttcaacggcgacgctgtgctcagctac
gagctgaaggacaagaacggcaagaccgtggccgcgtccgattcctccactccgctctcc
ggcgtgcgcgtcaagaccgcacagaccactccgatcgcgctggacggcgtgaccgaaggc
tctgaatacacgctcaccgtcaccggccgccagtccggcaaggccgtgaccgtcgacttc
caggctccggccgccaactccgctgacaagaacaacggcaagccgggcgctggcaacgct
gacaagaacggcgtgatcgcttccggcaaggtcaacaacgatacgaaggccggcccgttt
ggcgccgcactgctcggcaagaccggcaccgcggtgctggctgcggctgttgcgatcgcc
atgctggttgccgtcgcgatgctcatcaagaccgtgaaggccgccaagaacgaccgctga

DBGET integrated database retrieval system