KEGG   Bifidobacterium adolescentis ATCC 15703: BAD_1605Help
Entry
BAD_1605          CDS       T00437                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
bad  Bifidobacterium adolescentis ATCC 15703
Pathway
bad00052  Galactose metabolism
bad00511  Other glycan degradation
bad00600  Sphingolipid metabolism
bad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BAD_1605
  Lipid metabolism
   00600 Sphingolipid metabolism
    BAD_1605
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BAD_1605
Enzymes [BR:bad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BAD_1605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Bgal_small_N Glyco_hydro_2_N DUF4981 Glyco_hydro_2 BetaGal_dom4_5 Big_3_2
Motif
Other DBs
NCBI-ProteinID: BAF40386
UniProt: A1A3V3
Position
2046289..2049360
Genome map
AA seq 1023 aa AA seqDB search
MANETRIEHASETWLADSTVFEVNRVPAHSDHKCYAHDPQTNEWSDLRQSLDGEWRVEVV
QASDIEFNEEPFVRENFDDSAFERIQVPGHLQMAGLMNNKYVNIQYPWDGHENPAEPNIP
ENNHVALYRKTFTMANRLADTKNAGGTVSIVFHGMATAIYVWVNGMFVGYGEDGFTPNEF
DITEMLHDGENVVAVACYEYSSASWLEDQDFWRLHGLFRSVELAAQPHVHIENMQIESDW
DPESGSASLDAALTVRNAADAATISATLKDSDGNVVWETANCADPDTSISTGLLNGIRPW
SAEDPVLYEFEVTVIDHAGNIAEVAVQKVGFRRFRIEDGIMTINGKRIVFKGADRHEFDP
KRGRAITEQDMIDDVVFCKRHNLNAIRTSHYPNQERWYELCDEYGIYLIDETNLETHGSW
CLPGDVLTEETAVPGSKAHWEGACVDRVNSMVRRDYNHPSVLIWSLGNESYTGDVFRAMY
KRVHDIDPNRPVHYEGVTHNRDYNDVTDIETRMYAHADAIEEYLKNDPQKPYISCEYMHA
MGNSCGNMDEYTALERYPKYQGGFIWDFIDQAIYATQPDGTTSLRYGGDFGDRPSDYEFS
GNGLVFADRKPTPKAQEVKQLYSNVHIDVAEDSVTIKNDNLFTSTGEYTFVLRVLADGEP
VWQSERRFDVPAGSTEKLDVDWPLDLYRDGASELVLEVSQRLAKATNWAVAGYELAFGQT
VVAGSKKASAPVKPVDGIVTVGRWNVGVQGSGREVLLSRTQGGLVSYTFNNREFVLRRPA
VTTFRALTDNDRGAGHGFERAQWLGAGRYARCIGNEIEQIDENTVKASYTYELATPQRTK
VTVSYTADTTGRVNLHVEYPGEPGDLPTIPAFGIEWTLPVQYSNLRFFGAGPEETYQDRK
HAKLGVWSTDAFKDHAPYLMPQETGNHEDVRWAEITDEKGHGLRISRAEGAEPFAMSLQP
YSSFMLEEAQHQDELPAPKHMFLRVLAEQMGVGGDDSWMSPVHPQYHIPADQPISLDVDL
DLI
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgaaacccgcatcgaacacgcatccgagacctggctcgccgattcgaccgta
ttcgaggtcaaccgcgtcccggcgcattccgaccacaaatgctacgcgcacgatccgcag
accaacgaatggtccgatctgaggcagagcctcgacggcgaatggagggtcgaggtcgtt
caggcatccgacatcgaattcaacgaggagcccttcgtaagggagaacttcgacgattcc
gccttcgaacgcatccaggttcccggacacctgcagatggcgggattgatgaacaacaag
tacgtgaacattcaatacccgtgggatggccacgagaatccggcggaaccgaatattccg
gagaacaaccatgtcgccctctaccgtaagaccttcacgatggcgaaccgtctggccgac
accaagaacgccggcggaaccgtctccatcgtgttccacggcatggccaccgcaatctac
gtgtgggtcaacggcatgttcgtcggctatggcgaggacggcttcacccccaacgaattc
gacatcaccgagatgctgcacgacggcgagaacgtcgttgccgtcgcatgctacgaatac
tccagcgcctcatggctcgaggaccaggacttctggcgtctgcacggactgttccgctcg
gtcgagctggccgcgcagccgcatgtgcatatcgagaacatgcagatcgaatccgattgg
gatccggagtccggcagcgcctctttggacgcggcgctcaccgtgcgcaacgcagccgac
gcggccacgatctcggcgacgttgaaggattccgatggtaacgtcgtctgggagaccgcg
aactgcgctgaccccgatacctccatctccaccggattgttgaacggcatccgcccgtgg
agcgcggaggatccggtcctctacgagttcgaggtcacggtcatcgaccatgccggcaac
atcgccgaggtcgccgtccagaaggtcggattccgccgcttccgcatcgaggacggcatc
atgacgattaatggcaagcgcatcgtattcaagggcgccgaccgccacgagttcgatccc
aagcgcggacgcgcgatcaccgagcaggacatgatcgacgatgtggtcttctgcaagagg
cacaacctcaacgccatcaggacctcccactatccgaaccaggagcgctggtacgagctg
tgcgacgagtacggcatctacctgatcgacgagaccaacctcgaaacccatggcagctgg
tgcctgcccggtgacgtcctcaccgaggagaccgccgtcccgggaagcaaggcgcattgg
gagggcgcgtgcgtcgaccgtgtcaacagcatggtgcgccgcgactacaaccatccgagc
gtcctgatctggtctctcggcaacgaatcctacacgggcgacgtgttccgcgccatgtac
aagcgcgtgcacgacatcgacccgaaccgtcccgtgcactatgagggcgtgacccacaac
cgcgactacaacgacgtgaccgacatcgagacccgcatgtatgcgcacgccgacgccatc
gaggaatacctgaagaatgatccgcagaagccttacatctcctgcgagtacatgcacgcc
atgggcaattcgtgcggcaacatggacgaatacaccgcgctcgaacgctatccgaagtac
cagggcggcttcatctgggacttcatcgaccaggcgatctacgccacccagcccgatgga
accacgagccttcgctatggcggcgacttcggcgacaggccgagcgactacgagttctcc
ggcaacggcctggtgtttgcggaccgtaagcccacgccgaaggcccaggaggtcaagcag
ctgtattccaacgtgcatatcgatgtcgccgaggattccgtgaccatcaagaacgataat
ctgttcacctccactggcgaatacacgttcgtgttgcgtgtccttgcggatggcgaaccg
gtatggcagtccgaacgccgtttcgacgtgccggccggttcgacggagaagctcgatgtc
gactggccgttggatctgtaccgcgacggcgcgtccgaactggtgctggaggtatcccag
cgtctcgccaaggcgaccaattgggcggtagccggctatgagctggcattcggccagacc
gtcgtcgccggctccaagaaggcctctgctccggtgaagccggtcgacggcatcgtcacc
gttggccgttggaacgtcggcgtgcagggatccggccgcgaggtactgctttcccgcacc
caaggcggactggtctcctacacgttcaacaatcgagaattcgtgctgcgccgtccggcg
gtcaccacgttccgcgcgctgaccgacaacgatcgcggcgcaggccacggcttcgaacgc
gcccagtggctgggagcaggccgttacgcccgctgcatcggcaacgagatcgaacagatc
gacgagaacaccgtcaaggcctcctacacgtacgagctcgccaccccgcagcgcaccaag
gtgaccgtcagctacaccgccgacaccaccggacgagtgaatctgcacgtcgaatacccg
ggcgagccgggcgacctgcccaccatccccgcgttcggcatcgaatggacccttccggtc
cagtactcgaacctgcgtttcttcggcgctggtccggaggagacctaccaggatcgcaag
catgccaagctcggtgtgtggagcaccgacgcgttcaaggaccacgccccgtatctcatg
ccgcaggaaaccggcaaccatgaggacgtgcgttgggccgagatcacggacgagaagggc
catggccttcgcataagccgcgccgaaggcgccgaaccgttcgcgatgagcctgcagccg
tactccagcttcatgcttgaggaagcccagcatcaggacgagctccccgccccgaagcac
atgttcctgcgtgtgcttgccgagcagatgggtgtcggaggagatgactcctggatgtcc
ccggtccacccccagtaccatatcccggcggaccagccgatcagcctcgacgtcgatctc
gacctgatctga

DBGET integrated database retrieval system