KEGG   Bifidobacterium adolescentis: BAD_1616Help
Entry
BAD_1616          CDS       T00437                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bad  Bifidobacterium adolescentis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bad00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2072421..2073347
Genome map
AA seq 308 aa AA seqDB search
MSTIDSPAIGTATINAVSVDCPAKTNLTLHVGPSHAEWGGRHELDTIYCAVGVYDTVTAT
RKAPGSGFSLNLEGAYLGDLASSGSDMRRNHAVLALFAMAEASSHEPDVALNIDKRIPVG
AGMAGGSADAAATILALNTLWDLDWPIERLQEVAATLGADMPFCLTGGYARGTGFGERIE
QLDDDGDIVRDLTERGFTGHLLVGAYRAELRTPEVYATFDQIGAGDGDENHLQKAAVSLH
PRSGQAIEEALRAGASQAFVSGSGPSVIAFVPTEDAADAVQRAWQDSRCVDRIIATNAPA
RPIVHITA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccattgattcgcccgccatcggaacggccaccatcaacgccgtgagcgtggac
tgcccggcgaaaacgaatctgaccctgcatgtgggcccgtcgcatgccgaatggggcggc
cgtcatgaactcgacaccatctattgcgcggtcggcgtatacgacaccgtcaccgccacg
cgcaaagcgccgggaagcggcttctcgctgaatctcgagggcgcgtatctgggcgacctg
gcctcttccggcagcgatatgcgccgcaaccacgccgtgctggcattgttcgccatggcc
gaagcgagcagccatgagccggacgtggcgttgaacatcgacaagcgcatccccgtcggc
gcgggcatggccggcggttccgccgatgcggcggcgacgattctggcattgaacacgttg
tgggatctcgattggccgatcgaacgcctgcaggaagtcgcggccacgctgggcgcggac
atgccgttctgtctgaccggcggttacgcgcgcggcaccggtttcggcgaacgcatcgaa
cagcttgatgacgatggcgatatcgtacgcgatcttacggaacgtgggtttaccggccat
ctgctggtcggcgcataccgtgcggaactgcgcacgccggaagtgtatgccacattcgat
cagatcggtgccggcgatggcgatgagaaccacctgcagaaggcggcggtctccctgcat
ccgcgtagcggacaggcgatcgaggaagccttgcgtgcgggagccagccaggcgttcgtc
tccggttccggcccgtccgtcatcgcgttcgtgccgacggaggatgcggcggacgccgtg
cagcgggcatggcaggacagccgttgcgtcgatcgcatcatcgccacgaacgccccagcc
cgaccgattgtgcatatcaccgcatga

DBGET integrated database retrieval system