KEGG   Bifidobacterium adolescentis ATCC 15703: BAD_1616Help
Entry
BAD_1616          CDS       T00437                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bad  Bifidobacterium adolescentis ATCC 15703
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bad00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAD_1616 (ispE)
Enzymes [BR:bad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BAD_1616 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2072421..2073347
Genome map
AA seq 308 aa AA seqDB search
MSTIDSPAIGTATINAVSVDCPAKTNLTLHVGPSHAEWGGRHELDTIYCAVGVYDTVTAT
RKAPGSGFSLNLEGAYLGDLASSGSDMRRNHAVLALFAMAEASSHEPDVALNIDKRIPVG
AGMAGGSADAAATILALNTLWDLDWPIERLQEVAATLGADMPFCLTGGYARGTGFGERIE
QLDDDGDIVRDLTERGFTGHLLVGAYRAELRTPEVYATFDQIGAGDGDENHLQKAAVSLH
PRSGQAIEEALRAGASQAFVSGSGPSVIAFVPTEDAADAVQRAWQDSRCVDRIIATNAPA
RPIVHITA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccattgattcgcccgccatcggaacggccaccatcaacgccgtgagcgtggac
tgcccggcgaaaacgaatctgaccctgcatgtgggcccgtcgcatgccgaatggggcggc
cgtcatgaactcgacaccatctattgcgcggtcggcgtatacgacaccgtcaccgccacg
cgcaaagcgccgggaagcggcttctcgctgaatctcgagggcgcgtatctgggcgacctg
gcctcttccggcagcgatatgcgccgcaaccacgccgtgctggcattgttcgccatggcc
gaagcgagcagccatgagccggacgtggcgttgaacatcgacaagcgcatccccgtcggc
gcgggcatggccggcggttccgccgatgcggcggcgacgattctggcattgaacacgttg
tgggatctcgattggccgatcgaacgcctgcaggaagtcgcggccacgctgggcgcggac
atgccgttctgtctgaccggcggttacgcgcgcggcaccggtttcggcgaacgcatcgaa
cagcttgatgacgatggcgatatcgtacgcgatcttacggaacgtgggtttaccggccat
ctgctggtcggcgcataccgtgcggaactgcgcacgccggaagtgtatgccacattcgat
cagatcggtgccggcgatggcgatgagaaccacctgcagaaggcggcggtctccctgcat
ccgcgtagcggacaggcgatcgaggaagccttgcgtgcgggagccagccaggcgttcgtc
tccggttccggcccgtccgtcatcgcgttcgtgccgacggaggatgcggcggacgccgtg
cagcgggcatggcaggacagccgttgcgtcgatcgcatcatcgccacgaacgccccagcc
cgaccgattgtgcatatcaccgcatga

DBGET integrated database retrieval system