KEGG   Bacillus atrophaeus: BATR1942_00395Help
Entry
BATR1942_00395    CDS       T01339                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bae  Bacillus atrophaeus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BATR1942_00395
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BATR1942_00395
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BATR1942_00395
Enzymes [BR:bae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BATR1942_00395
Exosome [BR:bae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BATR1942_00395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(77602..78990)
Genome map
AA seq 462 aa AA seqDB search
MKIFPKKLLPIAVLSSIAFSSLASGSLPEANAQEKKKGNKEEIKNVIVLIGDGMGVSYTS
AHRYLKDNSATKVVEPTAFDQYLVGQQTTYPEDPEHNVTDSASAATAMSAGIKTYNNAIA
VDNDGSEAKTVLEAAKEKGKSTGLVATSEITHATPASFGSHDHSRKNMNSIANDYFDEMV
NGQHKIDVLLGGGKSNFDRKDRNLVKEFKKAGYSYVENREDMLKNKNGKVLGLFAEGGLP
KKIDRTKEIPSLKEMTNTALSKLSKDKDGFFLMVEGSQIDWAGHDNDIVGAMSEMDDFEQ
AYKAAIEFAKKDKHTLVVATADHSTGGYSIGADGIYNWFSEPIKAAKRTPDFMAEKIADG
ADVKKTLKKYIDQKKLALTEAEIQSVEQAAKSKKVLDIDNAIENIFNKRSHTGWTTGGHT
GEDVPVYAYGPSSEKFAGQIDNTKIAKNVFDVLQYKIKINDK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatattcccgaagaagttactgcctatcgctgttttgtcatctatcgcttttagc
agcttagccagcggcagtttacctgaagcaaatgcgcaggaaaagaaaaagggaaataaa
gaagaaattaaaaacgtcattgttttgattggtgatggaatgggcgtatcttatacttcc
gctcatcgttatttgaaggataattcagcaacaaaggttgtggagcctacagcttttgat
caataccttgtcggccagcaaaccacttacccggaagaccctgaacataatgtaacggat
tcggcttctgcagcaacggccatgtctgcgggcattaaaacatacaataatgcaattgca
gtggacaatgacggatcagaagcaaaaacggttcttgaagcggctaaagagaaagggaaa
tcgacaggacttgttgcaacatcagaaattacacacgcaacacccgcttcattcggctca
catgatcacagccggaaaaacatgaactccattgcgaatgactattttgatgaaatggta
aacggccagcataaaatcgatgttctgcttggcggcggtaagagcaattttgatcgtaaa
gaccgcaatttagtaaaagaattcaaaaaagcgggatacagctatgtggagaaccgcgag
gacatgttaaaaaataaaaacggcaaagttctcggcttattcgctgaaggcggcctccca
aagaaaattgaccgcacaaaagaaattccttcattaaaagaaatgaccaatacggctctt
tcaaaattaagcaaagacaaagacgggttcttccttatggtggagggaagccagattgac
tgggccgggcatgacaatgatattgtcggtgcgatgagtgaaatggatgactttgaacaa
gcatataaagcagccattgaatttgcgaaaaaggacaagcacacattagtagtcgcaacg
gctgaccactcaaccggcggatattccattggtgcagacggcatttacaactggttcagt
gaaccgatcaaagcagcaaagcgcacacctgactttatggcagaaaaaattgccgacggc
gcagatgtgaaaaaaacattaaagaaatatattgatcaaaaaaagttagctttaactgaa
gcagaaatacaatctgttgaacaagcagctaaatcaaagaaagtgcttgatatcgacaat
gcaattgagaacattttcaacaaacgctctcacaccggctggacaaccggcggccacaca
ggtgaagacgtccctgtatatgcatacggaccgtcaagtgagaaatttgctggccaaatc
gataatactaaaatcgcaaaaaatgttttcgatgtcctgcaatacaaaattaagattaac
gataagtaa

DBGET integrated database retrieval system