KEGG   Bacillus atrophaeus: BATR1942_01125Help
Entry
BATR1942_01125    CDS       T01339                                 

Definition
beta-galacturonidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
bae  Bacillus atrophaeus
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BATR1942_01125
  Lipid metabolism
   00600 Sphingolipid metabolism
    BATR1942_01125
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BATR1942_01125
Enzymes [BR:bae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BATR1942_01125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
236081..238072
Genome map
AA seq 663 aa AA seqDB search
MAKKLYHGACYYPELWDEETIQQDITIMRETGINVVRIGEFAWSVMEPEEGNINVNFFKE
IIGRLYENGIETIMCTPTPTPPIWLSHDRPERMYVNESGAIMGHGSRQHACTNHPYFRKK
AALITTSLAKELGRLPGVIGWQLDNEFKCHVGECMCETCLGLWHEWLKNRYGMIDRLNEA
WGTDVWSETYQSFEQVPQPGPAPFLHHASLRTMYQLFSMEKIAAFADEQARIIRIYSDAP
ISHNSTVMFSVDNERLFQSLDVASFDTYATQENASAFLFNCDLWRHFKKDRPFWILETSP
SYAASLESYALPHADGYLKAEAVSSYALGGEAFCYWLWRQQRSGSEIPHGSVLSAWGEKT
IGYKNVLDVERARKEIEPFIISTVPAQAEAAMTYSDRAKAFFRTEPHRELNHRSLVTSFY
ERILKAGIHRDVIPEHHPLDGYKLLFTPYVPYLSSDYIKKASAFAEAGGIWIAGPMTGGR
TKEHTIHTDCALGELEKTAGIKTLFTFPMDEDTDSGRAFGVCAPLGLWSAVFDANSGETV
GTIEKGPASGKAFLTEQKHGAGKIVLLGSTPSGKDGEAMLEALIVHYAKEAGLTFRTNVT
PGTIVAPRIGDSGLIWVIVNMDGKGGSVTLPEAGTDMLSALAVEAGSLSIGEYEYRIIQF
DRP
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaagctataccacggcgcgtgctattatccggaactatgggatgaggaaacg
attcagcaggacattaccattatgcgcgaaacaggcattaacgtcgttcgaatcggcgag
tttgcctggtctgtcatggagcctgaagaaggaaacataaatgtcaatttttttaaagaa
atcatcggccgtctgtatgaaaacggcatcgaaaccatcatgtgcacgccgacgccgaca
ccgcccatttggctctcgcatgaccgcccggagcgaatgtatgtgaatgaaagcggagcg
atcatggggcacggatcgcgtcagcacgcttgcaccaatcacccttatttcagaaaaaaa
gcagccttgatcacgacaagtctcgcgaaggaattggggaggctgcccggcgtgatcggc
tggcagctcgataatgagtttaaatgccatgtgggagaatgcatgtgtgaaacatgtttg
gggctgtggcatgaatggctcaagaatcgctacggtatgattgaccgtttaaatgaagcg
tgggggacggatgtgtggagcgaaacgtatcaatcgttcgaacaagtgccgcagccgggc
ccggccccatttttgcaccacgcttctctgcgcacgatgtatcagctgttttctatggaa
aagattgctgcatttgctgatgagcaggcaaggatcatcagaatctattcagatgcgccg
atttcccataacagcaccgtcatgttcagtgttgacaatgaacggctgtttcagagcctc
gatgtcgcgtcattcgatacgtacgctacacaggaaaacgcctccgcgttcttattcaat
tgtgatttgtggagacatttcaaaaaagaccggcccttctggatattggaaacaagccct
tcttacgccgcatcgcttgaaagctacgccttgccgcacgcagacggctatttaaaagcg
gaagcggtatcttcttacgcgttaggcggagaagcgttttgctattggctgtggagacag
cagcgttcaggcagcgagattcctcacggatctgttctcagcgcttggggagagaaaacg
atcggctataagaacgtgcttgacgttgagcgggcaaggaaggaaatcgagccgttcatc
atttcgaccgtgccggcacaggcggaagcagcgatgacatactccgacagagcgaaagcg
tttttcagaacggagcctcatcgagaactgaatcatcgctctttggttacctctttttac
gaacggattctgaaagccggcattcatcgggatgtgattcccgaacaccacccgctagac
ggctacaagctgcttttcacaccgtatgtgccttacctttcttccgactatatcaaaaaa
gcttcagcgtttgccgaagcgggagggatttggatcgcgggaccgatgacaggcggacgt
acaaaagagcatacgatccatacggattgcgcgctgggcgagcttgaaaaaacggcgggt
atcaaaacgcttttcaccttccctatggatgaagacaccgattccggaagggcatttggt
gtttgtgcgccgcttggcttatggagcgcggtttttgatgcgaattcaggagaaaccgtc
ggcaccatcgaaaagggcccggcctcaggcaaggcgtttttaacggaacaaaagcacggg
gcgggcaaaattgtcttgctcggatcaacgccttccggaaaagacggagaggctatgctt
gaagcgctcattgtccattatgccaaagaagccggtctcaccttccgaacgaatgttaca
ccaggaaccattgtggcgccgagaataggcgacagcggtttgatatgggtgatcgtaaat
atggatggaaaaggggggagcgtcacactcccggaagcgggaactgacatgctgtcagcc
cttgctgttgaagcgggaagtttgtccattggcgagtatgagtaccgaatcattcagttt
gacagaccatag

DBGET integrated database retrieval system