KEGG   Bacillus atrophaeus: BATR1942_01150Help
Entry
BATR1942_01150    CDS       T01339                                 

Definition
glycosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bae  Bacillus atrophaeus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BATR1942_01150
  Lipid metabolism
   00561 Glycerolipid metabolism
    BATR1942_01150
   00600 Sphingolipid metabolism
    BATR1942_01150
Enzymes [BR:bae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BATR1942_01150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
244267..245613
Genome map
AA seq 448 aa AA seqDB search
MFNIETVKQIKIAYIGGGSKGWARSLMSDLALDERMSGMVALYDLDFEAALQNEAIGNLS
GNGKWRYEAVSSLKKALSGADVTVISILPGTLDHMETDVHLPEQFGIYQSVGDTVGPGGI
IRGLRAAPMFADIACAIRDYAPDSWVMNYTNPMSVCTRMLYKVFPDIKAFGCCHEVFGTQ
KLLCEMVKERLGLNVKQREDIKVNVLGINHFTWVTEASFRHIDLVPVFQEFAAQYAETGY
EPSGESWRDSVFHSAHRVAFHLFETYGAIPAAGDRHLAEFFPAFYLKDPEKWKFHLTSVG
YRKQESLRRKKETDHMIKQKQGAALKASGEEGVNMIAALLGLGDLMTNVNLPNEGQAANL
PMGAIVETNAYITRNRVQPIFSGTLPKRLEMLANRHISNQEAVAEAGFTQDDSLAFQAFI
NDPLITLDRADAERLFREMLSCNQIGAR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgttcaatatcgaaacggtaaaacagataaaaatcgcttatatcggcggcggttccaaa
gggtgggccagaagcttgatgagcgatctggctcttgatgaacgcatgtcaggcatggtt
gccctgtatgatcttgattttgaagcggcgctgcaaaatgaagcgatcggcaatctcagc
ggaaacggaaaatggagatatgaagctgtttcttctttgaaaaaagcattatcaggagcg
gatgtgaccgtcatctcaatcctgccgggaacattagaccatatggaaacggatgtccat
ttgcctgaacagttcggcatttatcaatcagtgggtgacacagtcggaccgggcggaatc
attagaggtctgcgggctgcgccgatgtttgcggatattgcctgtgcgatcagagactac
gccccggactcatgggtcatgaattatacaaacccgatgtctgtctgtacgaggatgctg
tataaagtgtttcccgatattaaggcattcggctgctgtcatgaggtattcggcacacaa
aagctgctttgtgaaatggtaaaagaaagactgggattgaatgtgaaacagcgggaagac
atcaaagtcaatgtgctcggcattaaccactttacatgggtgacggaagcctcgttccgt
cacattgatttggttcccgtttttcaagagtttgcggcgcaatacgccgagacggggtat
gaaccctcgggggagagctggcgggacagcgtatttcattccgctcaccgtgtagccttt
catttatttgaaacgtacggcgcaatcccggccgcgggtgaccgccatcttgcggaattt
ttccccgccttttatttgaaagatccggagaaatggaagtttcatctgacctccgtcggc
tatcggaaacaagaatcgttaaggagaaaaaaagaaaccgaccatatgataaaacaaaaa
caaggtgccgcgctgaaagcatcgggtgaagaaggagtcaatatgattgcggccttgctg
ggactgggtgatctgatgacaaatgtgaacctccccaatgaaggccaggcagccaatctg
cctatgggagcaattgtggaaacgaacgcgtatatcacccgcaacagggtgcagccgatc
ttttcaggaacattgccgaagcgtttggaaatgctggcaaacaggcacatatcaaatcag
gaggcggtggcggaagccggtttcactcaggatgacagtcttgcttttcaagcattcatc
aacgatcctctcatcacgctagaccgagcagatgccgagcgtctctttcgtgaaatgctg
tcctgcaatcaaataggagcacgataa

DBGET integrated database retrieval system