KEGG   Bacillus atrophaeus: BATR1942_01195Help
Entry
BATR1942_01195    CDS       T01339                                 

Definition
bifunctional P-450/NADPH-P450 reductase 1
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bae  Bacillus atrophaeus
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BATR1942_01195
  Amino acid metabolism
   00380 Tryptophan metabolism
    BATR1942_01195
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BATR1942_01195
Enzymes [BR:bae01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BATR1942_01195
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BATR1942_01195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
251373..254558
Genome map
AA seq 1061 aa AA seqDB search
MKKTSPIPQPKTFGPLGNLPLIDKDRPTLSLSKLADEYGPIFQLNTPAGTTIIVSGHELV
EEICDESRFDKSIEGALEKVRAFSGDGLFTSWTHEPNWRKAHNILMPTFSQRAMKEYHSM
MVDIAVQLIQKWARLNPNEAVDVPGDMTRLTLDTIGLCGFNYRFNSYYRETPHPFINSMV
RALDEAMHQMQRLDFQDKLMVRTKRQFHHDIQTMFSLVDSIIAERKADGDQDEKDLLARM
LNVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKMKKAYEEVDQV
LTGPTPTYKQVLQLSYIRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPITPKDRISVLI
PQLHRDKEAWGENAEEFHPERFENPDQVPHHAYKPFGNGQRACIGMQFALHEATLVLGMI
LQYFKLIDHTNYELDIKQTLTLKPGDFKIRVQSRNQEAMNSAVLTSDEKAPDDQKEKPDT
KSASIVGVNNRPLLVLYGSDTGTAEGVARELADTASMHGVRTEVAALNDQIGKLPKEGAV
LIVTSSYNGKPPSNAGQFVQWLEEIKPGELTGVQYAVFGCGDHNWASTYQDVPRYIDEQL
AQKGAARFSARGEGDVSGDFEGQLDQWKQTMWSDAMNAFGLKLNENAEKERSTLSLEFVR
GLGGSPLARSYEAVHASVTENRELQSADSDRSTRHIEIALPPGVTYQEGDHLGVLPSNSQ
EKVNRILRRFGLKGNDQVTLTASGRSAAHLPLDRPVSLHDLLSYSVDVQEAATRAQIREL
AAFTVCPPHKRELEGLAEEGVYQEKILQKRISMLDLLEEYEACEMPFERFLELLRPLKPR
YYSISSSPRVNPEQAAITVGVVRSPAWSGHGEYRGVASNYLADRTPGDDIDMFVRTPESR
FQLPEDPEKPIIMVGPGTGVAPFRGFLQARAALKQEGKTLGEAHLYFGCRNDNDFIYRGE
LEAYEKEGIVTLHTAFSRKEGIPKTYVQHLMAENAEELISILDQGGHLYVCGDGSKMAPD
VEATLQKAYQSVHGVGEQEAQKWLGNLQTNGMYAKDVWAGI
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaacaagcccgattcctcagccaaaaacgtttggaccgcttggcaatcttcct
ttaattgataaagacaggccgactctgtcgcttagcaaattggcggatgagtatggcccc
atttttcaattgaatacgcctgcgggcacgacgatcattgtttctggccatgagttagta
gaagagatttgcgatgagtcccgctttgataaaagcattgaaggcgctttagaaaaagtc
cgcgctttttccggagacggattatttacaagctggacgcatgagcctaactggagaaaa
gcgcacaatattctaatgccgactttcagccagcgggccatgaaagagtatcactccatg
atggtcgatatcgccgtccagctgattcaaaaatgggccaggcttaaccctaacgaagca
gttgatgtgccgggagatatgactcggcttacattggacacgattggtttgtgcgggttt
aactatcgttttaacagctactatagagaaacgccccatccgtttattaacagtatggtt
cgcgcgcttgatgaagccatgcatcaaatgcagcggcttgattttcaagacaaacttatg
gtcaggacaaaacgccaatttcaccatgatattcaaaccatgttttctttagtagacagt
attattgctgaacgcaaggcagatggagatcaagacgaaaaagatttgcttgcccgaatg
ctgaatgtggaagacccggaaacaggggagaaattggatgatgagaatattcgttttcaa
atcattacatttttaattgcggggcatgaaacaacgagcggtttattgtcctttgcgatt
tactttttattgaaaaacccggataaaatgaaaaaagcgtatgaagaggtcgatcaggtg
ttaacaggtccgactcctacatacaaacaagtgctgcagctttcatatatccggatgatt
ttaaacgaatcattacgtttatggcccacagctccggcttttagcctttatgcaaaagaa
gacacagtgattggagggaaatatccgatcacgccaaaagatagaatttccgttctgatt
cctcagcttcaccgtgacaaagaggcttggggagagaacgcggaagaattccatcctgag
cggtttgaaaatccggatcaggtgccgcatcatgcctacaaaccgtttgggaatggacag
cgggcatgtatcggcatgcagtttgcccttcatgaggcgactcttgtgctggggatgatt
ctccaatattttaaattaattgatcatacaaattatgaactggacatcaaacaaacgtta
acgcttaaaccgggtgattttaaaatccgggttcaatcccgaaatcaggaggccatgaat
tcagctgttctgacatctgatgaaaaagccccggatgatcaaaaggagaaaccggacacg
aagagcgcttcaatcgtaggtgtcaataatcgtcctttgcttgtcctttacggctctgac
acggggaccgcagagggtgtggcgcgggaactcgcggatacggccagtatgcacggtgtc
cggactgaggtagcggctcttaatgatcagattggcaaattgccgaaagaaggagccgtt
ctgatcgtcacctcatcttataatggaaagccgccaagcaatgcgggacaattcgtgcaa
tggctcgaagaaatcaaaccgggtgagcttacaggtgttcaatatgctgtgtttggctgc
ggagatcataactgggccagtacgtaccaggatgtcccgcgatatattgatgagcagctt
gcccaaaaaggggcagcacggttctcagcacgaggcgagggcgatgtaagcggtgatttt
gagggacagcttgaccaatggaaacaaaccatgtggtcggacgcgatgaacgcattcggg
ctgaagctcaacgaaaatgcggagaaggaacgaagtacgctaagccttgagtttgtcagg
gggcttggcggatctcctttggcccggtcgtacgaagccgttcacgcatccgttacggaa
aatcgcgaacttcagtcagcggacagcgatcgaagcacccggcatattgagatcgcttta
ccgccgggagtgacgtatcaggaaggagaccaccttggggtgctgccaagtaatagtcag
gaaaaagtcaatcgaattctccgaagatttggcttgaaaggaaatgatcaagtcacactg
actgcaagcggacgcagcgcagcccatctgcctttggaccggcctgtcagtttacatgat
cttcttagctacagtgttgatgtacaagaagcagcgaccagggcacaaatacgggagctg
gcggcatttacagtttgcccgccgcataaacgcgaattggaaggtttggcagaagagggt
gtctaccaggaaaaaatactgcagaaacgcatttcgatgctggatcttctcgaagagtac
gaggcatgtgaaatgccgtttgaacggtttttggagcttttacgtccgcttaaaccgcga
tattattccatttcaagttctccgcgagtgaacccggaacaagctgccattaccgtcggc
gtggtccgaagtcctgcttggagcgggcatggcgaatatcgcggagtagcttcgaattac
ttggcggaccgtacgccgggggatgatattgatatgtttgtccgtacaccggaatctcgg
ttccagcttccggaagatcccgaaaaaccgatcatcatggtcggcccggggaccggtgtc
gctccattccgcggtttcttgcaggcacgcgcggctttgaagcaggaggggaaaacgctg
ggcgaggctcacttgtatttcggatgcagaaacgataacgattttatttatcggggcgag
cttgaggcatatgaaaaagaaggaatcgtaacgctccatacggctttctcccgaaaagag
ggcattccgaaaacgtatgtacagcacttaatggcggagaatgccgaggaattaatttct
atccttgaccagggagggcatctgtacgtttgcggcgatggcagtaaaatggcgccggat
gtagaggcgacgctacaaaaagcgtatcagtccgtacatggagtgggagagcaggaagca
caaaaatggctgggaaatctgcaaacaaacggtatgtatgcgaaagatgtctgggctgga
atttaa

DBGET integrated database retrieval system