KEGG   Bacillus atrophaeus 1942: BATR1942_01650Help
Entry
BATR1942_01650    CDS       T01339                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00010  Glycolysis / Gluconeogenesis
bae00020  Citrate cycle (TCA cycle)
bae00620  Pyruvate metabolism
bae01100  Metabolic pathways
bae01110  Biosynthesis of secondary metabolites
bae01120  Microbial metabolism in diverse environments
bae01130  Biosynthesis of antibiotics
bae01200  Carbon metabolism
Module
bae_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BATR1942_01650
   00020 Citrate cycle (TCA cycle)
    BATR1942_01650
   00620 Pyruvate metabolism
    BATR1942_01650
Enzymes [BR:bae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BATR1942_01650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H RnfC_N PYNP_C Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADP31288
UniProt: A0A0H3DZ01
Position
348222..349424
Genome map
AA seq 400 aa AA seqDB search
MAVKVVMPKLGMAMKEGEVSVWNKQVGDAVEKGESIASINSEKIEMEIEAPENGTLLDII
VKEGEGVPPGTAICYIGEEGEALQESENEKPEKEEQSPPQKTENKITRGIKQAAKSRVKI
SPVARKIAEKAGIPIETLEGTGPGGRIVKEDVLTALSAASEQKPDEDAHEEKEQKQTMTP
MRKVIAERMHASLQNSAQLTITMKADVTDLLSLQKQLASAAKERFGTKLTITHFVSRAAV
LALQQHPHLNSAYQDERIITYSHVHLGMAVSLDRGLVVPVIRHAEKLSLIELAKQVSESA
EKARQGNMASDNLQGSTFSITNLGAYGIEHFTPILNPPETGILGIGASYDTPVYKEEELV
RSTILPLSLTFDHRICDGAPAAAFLKTVKEYLEEPAGLIL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaaagtggtgatgccgaaattgggaatggcaatgaaagagggagaggtatcc
gtctggaataaacaagtcggcgatgctgtcgaaaaaggtgaaagcatcgcaagcatcaat
tcggaaaaaattgaaatggaaatcgaagcgcctgaaaacggcactctgctagatatcata
gtcaaagaaggagagggggttccgccggggactgcgatttgttatatcggtgaagagggg
gaggcacttcaggagagtgaaaatgaaaagcctgaaaaggaagagcaaagtccgccgcag
aaaacagaaaataaaatcacccgaggcattaaacaggcggcgaaaagcagagtgaaaatc
tctcctgttgcacgaaaaatcgctgagaaagccggtataccgatcgaaacgctcgaagga
acgggacccggaggcagaattgtcaaagaagatgtgttaacggcgctttcggcggcatcc
gagcaaaaaccggatgaagacgcccatgaagaaaaagaacaaaagcagacaatgacaccg
atgagaaaggttattgccgaaagaatgcacgccagcctgcaaaacagcgcccagctgacg
atcacgatgaaagcagatgtaacggacctgctcagcctgcaaaagcagcttgcgtccgct
gccaaagaacgcttcggcactaagctgacaatcacgcattttgtatcaagggcggcggtg
cttgcattgcagcagcacccgcatctaaacagtgcctatcaagacgaacggatcatcaca
tattctcatgttcacctcggaatggcggtctcccttgaccgcggtttggtcgttccggtc
attcgccatgctgaaaagctctcgctcattgagcttgccaagcaagtttcagaaagcgca
gaaaaagcccgtcaagggaatatggcaagcgataatctgcaagggtcaactttctcaata
accaatctgggcgcctatggaatcgagcattttacaccgattctaaatccgccggagaca
gggattttaggtataggcgcaagctatgacacacctgtttacaaagaagaggagcttgtc
agaagcaccattctgccgctcagcctcacctttgaccacagaatctgtgacggggcgccg
gcagcagcatttctgaaaacggtcaaagaatatcttgaggaaccagccggattgatttta
taa

DBGET integrated database retrieval system