KEGG   Bacillus atrophaeus: BATR1942_02760Help
Entry
BATR1942_02760    CDS       T01339                                 

Definition
serine alkaline protease (subtilisin E)
Orthology
K01342  
subtilisin [EC:3.4.21.62]
Organism
bae  Bacillus atrophaeus
Brite
Enzymes [BR:bae01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.62  subtilisin
     BATR1942_02760
Peptidases [BR:bae01002]
 Serine Peptidases
  Family S8: subtilisin family
   BATR1942_02760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(575990..577138)
Genome map
AA seq 382 aa AA seqDB search
MRSRKLWIGLLFAFTLVFTMAFSSMSPAQAAGKSSEEKKYIVGFKQTMGAMSAAAKKDVI
AENGGKLQKQFKYVDAATATLDKEAVKELKNDPSIAYVEEDHTAHALAQSVPYGISQIKA
PAVHSQGYTGSNVKVAVIDSGIDSSHPDLKVSGGASFVPSEPNPFQDGNSHGTHVAGTVA
ALNNSVGVLGVAPSASLYAVKVLSSSGSGDYSWIINGIEWAISNNMDVINMSLGGPQGST
ALKAVVDKAVSQGIVVVAAAGNSGSSGSTSTVGYPAKYPSVIAVGAVDSNNQRASFSSAG
SELDVMAPGVSIQSTLPGSSYGSYNGTSMASPHVAGAAALVLSKHPNWTNSQVRNSLEST
ATNLGNSFYYGKGLINVQAAAQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgagaagcaggaaattatggatcggcttgttgtttgcattcactttagtctttacgatg
gcgttcagcagtatgtccccggctcaggctgcaggaaaaagcagtgaagaaaagaagtat
attgtcggatttaaacagacaatgggggcaatgagcgccgcagcgaaaaaagatgtcatt
gctgaaaacggcggaaaattacagaaacagttcaagtatgtagatgcggcgacagcgact
ttagacaaagaggctgtaaaagagctgaaaaatgatccaagcatcgcatacgtggaagaa
gatcacacagctcacgcattagctcagtcagtaccttatggcatctcccaaatcaaagcg
cctgctgtacattcccagggctacaccggctctaacgttaaagtcgctgtaatcgacagc
ggtatcgactcttctcatcctgatttaaaagtcagcggcggagcaagctttgtcccgtct
gagccaaaccctttccaagatggaaattcacacggaactcacgttgccggaactgttgca
gcgcttaataactcagttggtgtacttggtgtcgcgccaagcgcatccctatatgctgta
aaagttctttcttcttcaggaagcggtgattacagctggattattaacggaatcgaatgg
gcaatttccaacaacatggacgtcattaatatgagccttggcggaccacaaggttcaaca
gctttaaaagcagttgtagataaagctgtttctcaaggaatcgttgtagtggcggcagcc
ggaaacagcggttcatcaggaagcacaagcacagtcggctatcctgcgaaatacccttct
gtcattgcggttggcgcggttgacagcaataaccaaagagcatctttctccagcgcaggc
tctgagctagatgtcatggcaccgggcgtttcaattcaaagcacacttccgggcagcagc
tacggttcttacaacggaacatcaatggcttctccgcatgttgccggagccgctgcattg
gttctttctaagcaccctaactggacaaactctcaagtccgcaacagtttagaaagcact
gccactaaccttggaaactctttctactacggaaaaggcttaatcaacgttcaggcagca
gcgcaataa

DBGET integrated database retrieval system