KEGG   Bacillus atrophaeus 1942: BATR1942_03780Help
Entry
BATR1942_03780    CDS       T01339                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00860  Porphyrin and chlorophyll metabolism
bae01100  Metabolic pathways
bae01110  Biosynthesis of secondary metabolites
bae01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BATR1942_03780 (hemD)
Enzymes [BR:bae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BATR1942_03780 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ADP31710
UniProt: A0A0H3DXK2
Position
755029..755847
Genome map
AA seq 272 aa AA seqDB search
MGKGLLGKRIAIGGSRKTEEISTLIKKQGGVPVVRSLQGTVFLADKQVEPDLRRFVEEQA
DWVIFTTGIGTETLVDLAEKIGVKEPFLTTLRGAKIACRGYKTFATLKKMDMIPAAVDED
GTTGGLIRSLEAYGFSGKRVMVQLHGEKAPSLMTFLKEKGASVLPILPYRHIPPEPETVD
LLCRELMDRKLDAVCFTTAVQVRSLFDFAREKGCINQIKDAFKEDVLASAVGKVTAEALR
EEGISRLLAPDIERMGAMIIELSRFYEAQPEN
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaggattacttgggaagcgcattgccatcggcgggtcgcggaaaacggaagaa
atcagcacgctgatcaaaaaacaagggggagtgcctgttgttcgttctcttcaagggacg
gttttcttagctgacaagcaagtggaacccgatttacgtagatttgttgaagaacaagca
gattgggtgatttttacgaccggtatcggtactgagactttggtcgacttggcagaaaaa
atcggagtgaaggagccatttttaacaacgcttcgaggagcgaaaattgcttgcagagga
tacaaaacatttgccactttgaaaaaaatggacatgattccggcagcagttgacgaggat
ggaacaaccggggggctgatacgctctttagaagcgtatggtttttcgggaaaaagggtc
atggtgcagcttcatggagaaaaggcgccgtcgttaatgacttttcttaaagaaaaagga
gcatctgtattgccgattctaccttatcgtcatattccgcctgaaccggaaactgtggac
ttattatgccgtgaactgatggatcgtaagcttgacgcggtctgttttaccacggcggtt
caggtccgttcgctttttgattttgccagagaaaaaggctgcattaatcaaatcaaggat
gcatttaaggaagacgtcttagcgtcagctgtcggcaaagtgaccgctgaggcgctacgg
gaagaaggaatcagccgattgctagcgcccgatattgagcggatgggcgctatgattata
gagctgtcccgcttctatgaggcgcagccggaaaattaa

DBGET integrated database retrieval system