KEGG   Bacillus atrophaeus: BATR1942_04565Help
Entry
BATR1942_04565    CDS       T01339                                 

Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bae  Bacillus atrophaeus
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BATR1942_04565
Enzymes [BR:bae01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     BATR1942_04565
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     BATR1942_04565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
889999..890532
Genome map
AA seq 177 aa AA seqDB search
MATIRIQDEANTIIENQEEVASFLDSQEVIYEQWDITKLPEQLIEKYDLSDEEKQQILDT
FDAEIQDISTRRGYKAQDVISLSDANPKLDELLQNFIKEHHHTDDEVRFIVSGHGIFVIQ
GKDGTFFDVRLNPGDLISVPENIRHYFTLQEDRKVVAVRIFVTSEGWVPIYEKESIQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtggcaacaatcagaatacaggatgaggcaaatacaatcattgagaatcaagaggaagtg
gcaagctttttagacagtcaagaagtcatctatgaacaatgggatattacgaagcttcca
gaacagctgatagaaaaatacgacttgtccgatgaagagaaacagcagattcttgacact
tttgatgccgagattcaagatatttccacccggcgcggatataaagcgcaggatgtaatc
tctctatccgatgcaaatccgaaactcgatgagctgctgcaaaattttataaaagaacac
catcatacagatgatgaagttcgttttatcgtaagcggccacggcatatttgtcattcaa
ggcaaagacggcacctttttcgatgtccgtttaaaccctggagatttaatctcagttcct
gaaaacattcgtcactatttcactcttcaagaagaccgtaaagttgttgccgtccgaatc
tttgtcacgtcagagggctgggttccaatttatgaaaaggaaagtatacagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system