KEGG   Bacillus atrophaeus 1942: BATR1942_05070Help
Entry
BATR1942_05070    CDS       T01339                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00010  Glycolysis / Gluconeogenesis
bae00020  Citrate cycle (TCA cycle)
bae00620  Pyruvate metabolism
bae01100  Metabolic pathways
bae01110  Biosynthesis of secondary metabolites
bae01120  Microbial metabolism in diverse environments
bae01130  Biosynthesis of antibiotics
bae01200  Carbon metabolism
Module
bae_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BATR1942_05070
   00020 Citrate cycle (TCA cycle)
    BATR1942_05070
   00620 Pyruvate metabolism
    BATR1942_05070
Enzymes [BR:bae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BATR1942_05070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N DUF1533 DUF5077
Motif
Other DBs
NCBI-ProteinID: ADP31968
UniProt: A0A0H3E0V2
Position
987249..988583
Genome map
AA seq 444 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKPNDEVDEDDVLAEVQNDKAVVEIPSPVKGKVLELK
VEEGTVATVGQTIITFDAPGYEDLQFKGSEESGDAKTEAQVQSTGEAGQDVAKEERAEEP
AKATGAGQQDQAEADPNKRVIAMPSVRKYAREKGVDIKKVTGSGNNGRVVKEDIDSFVNG
GASQETAAPQETASKESAAKPAAAAPAPEGEFPETREKMSGIRKAIAKAMVNSKHTAPHV
TLMDEIDVTNLVAHRKQFKQVAADQGVKLTYLPYVVKALTSALKKFPVLNTSIDDKTDEV
VQKHYYNIGIAADTEKGLLVPVVKNADRKAIFEISDEINGLATKAREGKLAPAEMKGASC
TITNIGSAGGQWFTPVINHPEVAILGIGRIAEKAIVRDGEIVAAPVLALSLSFDHRMIDG
ATAQNALNHIKRLLNDPQLILMEA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaacttccagatatcggggaaggtatccacgaaggcgaaatcgta
aaatggtttgtcaagccaaacgacgaggtagacgaagatgatgtgcttgcagaagtacaa
aatgataaagcagtagtagaaattccttcacctgtaaaaggaaaagtattagaattaaaa
gttgaagagggaacagttgcaactgttggacaaacgattattacgtttgatgcacctggt
tacgaagaccttcaatttaaaggaagcgaagagtcaggcgacgcaaaaactgaagcgcaa
gttcagtcaactggtgaagccggacaagacgtagctaaagaagaacgcgcagaagagcct
gctaaagcaactggtgccggacaacaggaccaagcggaagcagatccgaataaacgcgtt
atcgcgatgccttctgttcgcaaatatgcgcgcgaaaaaggcgttgatatcaaaaaagta
acaggttctggaaacaacggacgtgttgtaaaagaagatattgacagcttcgtaaatggg
ggagcatctcaagagacagctgcgccgcaagaaacagcatcgaaagaatctgctgctaag
ccggctgctgctgcaccagctcctgaaggcgagttccctgagacacgcgaaaaaatgagc
ggtatccgcaaagcaattgctaaagcgatggttaactctaaacatactgctcctcacgtt
actctaatggacgaaattgatgtaacaaaccttgttgctcatcgtaaacagttcaaacag
gttgctgctgatcaaggagttaagctgacatacttgccttatgttgttaaagctcttaca
tctgcacttaaaaaattccctgttctaaacacttcaattgacgataaaacagatgaagtt
gttcagaagcattactacaacatcggtatcgctgctgatactgaaaaaggcttgttagtt
cctgttgtgaaaaatgctgatcgtaaagcgatctttgaaatttctgatgaaatcaacggc
cttgcaacaaaagcacgtgaaggtaagcttgctcctgcagaaatgaaaggcgcatcttgc
acaatcactaacatcggttctgcgggcggacaatggttcactccggttatcaaccatcca
gaggttgcaattctcggaatcggccgcattgctgaaaaagcgattgtacgtgacggcgaa
attgtagctgctccagtcttggctctttctctcagctttgaccaccgtatgattgacgga
gcaactgcacaaaatgcgttaaatcacatcaagcgtttactaaacgatccacaattaatt
ttaatggaggcgtaa

DBGET integrated database retrieval system