KEGG   Bacillus atrophaeus: BATR1942_05205Help
Entry
BATR1942_05205    CDS       T01339                                 

Definition
pyruvate carboxylase (EC:6.4.1.1)
Orthology
K01958  
pyruvate carboxylase [EC:6.4.1.1]
Organism
bae  Bacillus atrophaeus
Pathway
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BATR1942_05205
   01230 Biosynthesis of amino acids
    BATR1942_05205
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BATR1942_05205
   00620 Pyruvate metabolism
    BATR1942_05205
Enzymes [BR:bae01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     BATR1942_05205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1012107..1015556
Genome map
AA seq 1149 aa AA seqDB search
MSQQQLIQKVLVANRGEIAIRIFRACTELNIRTVAVYSKEDSGSYHRYKADEAYLVGEGK
KPIDAYLDIEGIIEIAKRNQVDAIHPGYGFLSENIQFAKRCEEEGIVFIGPTSEHLNMFG
DKVKAREQAEKAGIPVIPGSDGPAETLEAVEQFGQAHGYPFIIKASLGGGGRGMRIVRSE
NEVKEAFERAKSEAKAAFGNDEVYVEKLIENPKHIEVQVIGDKNGNVVHLYERDCSVQRR
HQKVIEVAPSVSLSNELRDQICEAAVALAKNVQYINAGTVEFLVANDEFFFIEVNPRVQV
EHTITEMITGVDIVQTQILVAQGYELHSREVNIPEQKDIFTIGFAIQSRVTTEDPLNDFM
PDTGKIMAYRSGGGFGVRLDTGNSFQGAVITPYYDSLLVKLSTWALTFEQASAKMVRNLQ
EFRIRGIKTNIPFLENVAKHEKFLTGQYDTSFIDTTPELFVFPKQKDRGTKMLTYIGNVT
VNGFPGIGKTEKPAFDKPHTVKVNIDEEPKKGTKQILDERGAEGLANWVKEQKSVLLTDT
TFRDAHQSLLATRIRTNDLKKIANPTSVLWPELFSMEVWGGATFDVAYRFLKEDPWKRLE
DLRKEVPNTLFQMLLRSSNAVGYTNYPDNVIQEFVKQSAHSGVDVFRIFDSLNWVKGMTL
AIDAVRKTGKVAEAAICYTGDILDKSRSKYDLAYYTSMAKELEAAGAHILGIKDMAGLLK
PQAAYELVSALKETVDIPVHLHTHDTSGNGIYMYAKAAEAGADIVDVAVSSMAGLTSQPS
ASGFYHAMEGNGRRPNMNVQGVELLSQYWESVRKYYNEFESGMNSPHTEIYEHEMPGGQY
SNLQQQAKGVGLGDRWNEVKTMYRRVNDMFGDIVKVTPSSKVVGDMALYMVQNNLSENDV
YEKGETLDFPDSVVELFKGNIGQPHGGFPEKLQKLILKGQEPITVRPGELLEPVSFEAIK
QEFKEKHGTEITDQEAVAYALYPKVFTDFVKTAENYGDISVLDTPTFFYGMTLGEEIEVE
IERGKTLIVKLVSIGEPQPDATRVLYFELNGQPREVVIKDESIKSSVQEKLKADRSNPNH
IAASMPGTVIKLLTEAGAKVEKGDHLMINEAMKMETTVQAPFSGTITNVHVKNGDPIQTG
DLLLEIEKA
NT seq 3450 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacaacaacagttgatacaaaaggttttagttgccaacagaggggaaatcgctatt
cggatattccgggcttgtacagagctgaatatccgtacagttgcggtttactcaaaagaa
gattcaggttcttatcatcgctacaaagcagatgaagcgtatctggtcggtgaaggtaaa
aagccgattgacgcttatctggatatcgagggaatcattgaaattgcaaagagaaaccag
gtggacgctattcacccgggatacggtttcttatctgaaaatatacaatttgcgaaacgg
tgtgaagaggaagggatcgtctttatcggaccgacttcagagcatttaaatatgtttggt
gacaaagtgaaagcccgtgagcaagcggaaaaagcaggaatccctgttataccgggaagc
gacggaccggcagaaaccctcgaagctgttgagcaattcggacaagcacatggctatccg
ttcattattaaagcttcacttggcggcggcggacgcggtatgaggattgtaagaagtgaa
aatgaagtcaaagaagcgtttgaacgtgcgaaatctgaagcgaaagcagcctttggaaat
gatgaagtttatgtagagaaactgatcgaaaacccaaaacatattgaagtccaggtgatt
ggggataaaaacggcaatgtcgttcatctctatgaaagagactgctccgttcaaagacgc
catcaaaaagtcatcgaggtagcaccaagtgtgtcgctatcaaatgaattgagagatcag
atttgcgaagctgcagtggcgctcgctaaaaatgttcaatacataaatgcagggacagta
gaatttctggttgctaacgacgagtttttcttcattgaagtaaacccgcgtgtacaggtc
gagcatacgattacagaaatgattacaggagtcgatattgttcaaacgcagattctagtt
gcacaagggtacgaactgcacagccgtgaagtaaacattcctgagcaaaaggatattttc
acaatcggtttcgccatccagtctcgtgtcacaacggaagatccgctgaacgattttatg
cctgatacagggaaaatcatggcttaccgctcaggcggcggcttcggtgtccgcctcgat
actggaaacagttttcagggcgcagttattacaccgtattacgactctctgctcgtgaag
ctgtccacgtgggctttaacatttgaacaggcatcagcaaaaatggttcgaaaccttcaa
gaattccggattagaggaattaaaacaaatattccgtttcttgaaaatgtggctaagcat
gaaaaattcctgacaggccagtacgatacgtcctttatcgatacaacgcctgaattattc
gtattcccaaaacagaaggaccgcggcacaaaaatgctgacttatatcggcaacgtgaca
gttaatgggttcccggggattggaaaaacagaaaaacctgcctttgacaagccgcatacg
gttaaagtgaatattgatgaagagcctaaaaagggcacaaagcaaattctcgatgaaaga
ggggctgaaggtctggcgaattgggtaaaagagcaaaaatctgttcttttaacggataca
acattcagagacgcccatcagtcactattagcaaccagaatcagaacaaatgatttgaag
aaaatcgctaatcctacgtctgtgttatggcctgaactcttcagtatggaggtttgggga
ggcgcgacctttgatgtagcgtaccgtttcttgaaagaagatccttggaagcgcctggag
gatttacgcaaggaagtgccgaatacgctgttccaaatgctgcttcgttcttcaaatgca
gtcggctatacaaattatcccgacaatgtcattcaggagtttgtgaaacagtccgcccat
tccggcgttgatgtgttccggattttcgacagtcttaactgggtaaaaggaatgacactg
gcaattgatgcggtgcgcaaaacggggaaagtagcagaagcggcaatctgttataccgga
gatattcttgataagagccgctctaaatatgatttggcttactatacatctatggcgaag
gagcttgaagcagccggagcccatatattaggcattaaagatatggccggcctgttaaag
cctcaggcggcatatgaattagtgtctgcgttaaaagaaacagttgatattccggttcat
cttcatacgcatgatacaagcggcaacggaatttacatgtatgcgaaagcagcagaagca
ggcgcggacatcgttgacgtggctgtaagctcaatggcgggcttaacatctcagccgagc
gcaagcggattttatcatgcaatggaagggaacggccgccgcccgaatatgaatgtacag
ggcgttgagttgctgtcgcagtattgggagtcagtccgtaaatattacaatgaatttgaa
agcggaatgaactcgccgcatacagaaatttatgagcatgagatgccgggcggacaatac
agcaaccttcagcagcaggcgaagggtgtagggctcggcgaccgctggaatgaagtgaaa
acgatgtacagacgtgtaaatgacatgtttggcgacattgtgaaggtgacgccatcctct
aaggtagtcggagacatggccctttatatggtgcaaaacaacctgtctgaaaatgacgtt
tacgaaaaaggcgaaacactggattttcctgactctgttgtggagctgtttaaaggaaat
atcggccagccgcacggcggatttccggaaaaacttcaaaaactgatcttaaaaggccaa
gagccgatcacggtcagacctggtgaattgcttgaaccagtatcctttgaagcaattaaa
caggaatttaaagaaaaacatgggacggaaatcacagatcaggaagcagtggcttatgcg
ctctaccctaaagtatttactgactttgtgaaaacggctgaaaactatggcgatatttcc
gtattagacacgccgactttcttttacggcatgacactcggtgaagagatcgaagttgaa
attgaacgcggaaaaacattgattgtgaagctcgtttcgattggtgagcctcagcctgat
gccacacgtgtcctttacttcgaactgaacggtcagccgcgtgaggttgtcataaaggat
gaaagcattaaatcttccgttcaggagaaattaaaggccgaccggtctaacccaaatcac
attgcggcatctatgcccggcactgttattaagctattgacggaagctggagcgaaggtg
gaaaaaggtgatcatctgatgattaacgaagcaatgaaaatggaaacaactgtacaggcg
cctttctcaggaacaataacaaatgtacatgtgaaaaacggagatccgattcaaacaggt
gatcttctgcttgaaatagaaaaggcttga

DBGET integrated database retrieval system