KEGG   Bacillus atrophaeus 1942: BATR1942_05635Help
Entry
BATR1942_05635    CDS       T01339                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00230  Purine metabolism
bae01100  Metabolic pathways
Module
bae_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BATR1942_05635 (gmk)
Enzymes [BR:bae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BATR1942_05635 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 HEM4 AAA_22 AAA_16 RsgA_GTPase ABC_tran AAA_29
Motif
Other DBs
NCBI-ProteinID: ADP32081
UniProt: A0A0H3DZ04
Position
1100598..1101212
Genome map
AA seq 204 aa AA seqDB search
MKERGLLIVLSGPSGVGKGTVRQAIFSQEDTKFEYSISVTTRSPRAGETDGVDYFFKTRD
EFEQMIANNKLLEWAEYVGNYYGTPVDYVEQTLQEGKDVFLEIEVQGALQVRNAFPEGLF
IFLAPPSLSELKNRIVTRGTETDALIENRMKAAKAEIEMMDAYDYVVENDNIETACEKIK
AIVLAEHLKRERIAPRYKKMLEVE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaagagggttattaatcgttctctcaggtccctcaggagttggtaaaggaacg
gtaaggcaagcaatattttcacaagaggatacaaaatttgaatattcgatttcagtgacg
acgagaagcccgagagcgggagagacagacggagtcgattatttcttcaaaacaagggat
gagttcgagcagatgattgcaaataacaagctgcttgaatgggctgagtatgtcggaaat
tattacggcacgcccgtcgattatgtcgaacaaacgctccaagagggaaaagacgtcttt
ttggagatcgaagtccagggtgcgcttcaagtgagaaacgctttcccggaaggtctgttt
attttcctggcgcctccgagcctttctgaactgaaaaacagaattgtcacaagaggaacc
gagacagacgccctgattgaaaatcggatgaaagctgctaaggctgagatcgaaatgatg
gacgcttacgattatgtcgttgaaaatgacaacattgagacagcttgcgaaaaaattaaa
gcgattgtcctcgcggagcatttaaagcgtgaacgcattgctccgagatataagaaaatg
ctggaggtagaataa

DBGET integrated database retrieval system