KEGG   Bacillus atrophaeus: BATR1942_06010Help
Entry
BATR1942_06010    CDS       T01339                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bae  Bacillus atrophaeus
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bae00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BATR1942_06010
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BATR1942_06010
Enzymes [BR:bae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BATR1942_06010
Two-component system [BR:bae02022]
 CheA family
  CheA-CheYBV
   BATR1942_06010
Bacterial motility proteins [BR:bae02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BATR1942_06010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1170051..1171118
Genome map
AA seq 355 aa AA seqDB search
MIRVLVVDDSAFMRKLISDFLPAESQIEVIGTARNGEEALQKINALQPDVVTLDIEMPVM
NGTDTLQKILDTYQLPVIMVSSQTQQGKEVTIDCLEMGAFDFITKPSGSISLDLYKIKEQ
LVERVIAAGLSTEQKTEAAPITPPPPRRAAKIELVKPISAAAKHIVCLGTSTGGPRALQK
VIPKLPKDLKAPVLIVQHMPEGFTASLADRLNHLSDIQVKEAKDGEMASEGCVYIAPGGK
NMSVVKTGAGLQISLDSKVTPSRHKPSVDYLFRSVSRLSDYAKVAVIMTGMGSDGTEGIK
EILAAGNVKTIAESEESCVVFGMPKSAIKAGLIHEIKHVEDIAAAITSSVKKERV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgattcgtgttcttgtagttgatgattcagcatttatgagaaaactgataagcgatttt
ctacccgccgaaagtcagatagaagtaatcggaacagcgagaaacggagaagaggcgctg
caaaaaattaatgcgcttcagccagacgttgtgacgcttgatattgagatgcctgtaatg
aatggaacagatacgctgcaaaaaattctcgatacctatcaattgccggtcattatggta
tctagccaaacgcagcaaggaaaagaagttacaattgactgtttggagatgggggcgttt
gattttatcacaaagccctccggctctatttctctggatttatataaaataaaagaacaa
ttggtggaaagagtaattgcagcagggctctcaacggaacaaaagactgaagctgcacca
attactccccctccgccaaggcgcgccgccaaaattgagttagtaaaaccgatatctgcc
gccgcaaagcacattgtttgtctcggcacgtcaacgggcggcccccgggcattgcagaag
gtaattccgaaactgccgaaggatctgaaagcgccggttctcattgtccagcatatgcct
gaagggtttacggcatctttagccgacagattaaatcatttgtcagatatacaagtaaaa
gaagcaaaagatggcgaaatggcgtcagaaggctgtgtttacattgcgccgggcggtaaa
aacatgtcggttgtaaaaacgggcgccggacttcagattagtcttgacagcaaagtgacg
ccaagccgccataaaccgtcagtcgattatttgttccgatctgttagccggctttctgac
tatgcaaaggttgcggtgattatgaccggcatgggaagtgacggcacagaaggcatcaaa
gaaattcttgcggcgggtaatgtgaaaacaatagctgaatctgaagaatcctgtgttgta
tttggaatgccgaaatcggcaattaaagcaggcctcatacatgaaatcaagcatgtagaa
gatatcgcagcagccatcacaagcagtgtgaaaaaagagagggtgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system