KEGG   Bacillus atrophaeus: BATR1942_06075Help
Entry
BATR1942_06075    CDS       T01339                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bae  Bacillus atrophaeus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BATR1942_06075
Enzymes [BR:bae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BATR1942_06075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1181167..1182318
Genome map
AA seq 383 aa AA seqDB search
MKNICLLGATGSIGEQTIDVLRAHPDQFQLVSMTFGRNAEKAVPMIEAFKPKFVAVGDQD
TYNKLKQVSFSYNVHIGIGEEGLIEAAVMEEVDIVVNALLGSVGLIPTLKAIEQKKTIAL
ANKETLVTAGHIVKEHAKIYGVPLLPVDSEHSAIFQALQGEQSKNIERLIITASGGSFRD
RTRKELESVTIEDALKHPNWSMGAKITIDSATMMNKGLEVIEAHWLFDIPYEQIDVVLHK
ESIIHSMVEFHDRSVIAQLGTPDMRVPIQYALTYPDRLPLPEAKRLELWEIGSLHFEKAD
FERFRCLQFAFDSGKIGGTMPTVLNAANETAVAAFLAGEISFLSIEDLIERALNRHQVIH
QPSLSDIQEVDKDTRGYVNSILT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaatatttgtcttttaggagcaacaggatcgattggggaacagacgattgatgta
ttgcgggcgcacccagaccaatttcagcttgtgtctatgacattcggccgcaatgcggaa
aaggctgtccctatgatagaagcctttaaaccgaaatttgtcgcagtcggtgatcaggat
acatataacaaattaaaacaagtctctttctcttataatgttcatattggcatcggtgaa
gaaggcctgattgaagcggcggtaatggaagaagtcgatatcgtcgtgaatgcgctgctt
ggcagcgtaggcttaattcccactttaaaggcgattgaacagaaaaaaacaattgcgctt
gcaaataaggaaactcttgtcacggccgggcatatagtaaaagaacacgctaaaatctac
ggtgtccctctattgcctgttgacagtgagcattcagcaattttccaagcgttgcaggga
gaacaaagtaaaaacatagaacgccttattatcacagcttctggggggagtttcagagac
cgcacccgaaaagagctggaatcggttacgatagaggatgcattaaagcacccgaattgg
tcaatgggtgcaaaaatcaccattgattcggctacaatgatgaataaggggctagaggtg
atcgaagcacattggcttttcgatattccgtatgaacagattgatgtcgtgttacataag
gaaagcatcatccattcaatggtagaatttcacgacagaagtgtgatcgcgcagcttggc
actccggatatgagagttccgattcaatacgcgctcacctacccggaccggctgccgctg
ccggaagcaaaaaggcttgagctatgggaaatcggaagcctccattttgaaaaagcggat
ttcgaaaggttccgctgcttacaatttgcttttgattcaggtaaaatagggggaacgatg
cctacggtgctaaacgcagcgaacgaaacggcagtcgccgcttttttagccggagagatt
tcgtttctgtctattgaagacctcattgaaagggcattaaaccgacatcaagtcattcat
cagccaagcttgtcggacattcaagaagtggacaaagatacacggggatacgtcaattca
atactcacataa

  All links  
No link information was found.   
DBGET integrated database retrieval system