KEGG   Bacillus atrophaeus 1942: BATR1942_07400Help
Entry
BATR1942_07400    CDS       T01339                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bae  Bacillus atrophaeus 1942
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BATR1942_07400
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BATR1942_07400
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BATR1942_07400
Enzymes [BR:bae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BATR1942_07400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1556219..1557322)
Genome map
AA seq 367 aa AA seqDB search
MKQFICNSCGKKHDITPTLWKCECGGVLNIVKDTPKVDTSAWNNYPNSLWRYFETMPFAK
DSKTWESVTMGEGQSPIIVLDPTEPNTYVKVDYMMPTLSFKDRGAVVLMTKAKELGVSKV
IADSSGNAGTAIAAYAARCNIACDIYLSDETSPKKIAQIKAHGATIKEIRGTREDIAAAA
QKAVDEEKVFYASHVYNPYFYEGTKTYAYEIYEQLNSAPDALIIPVGNGTLLLGAYYGFK
ELFENGLIDKIPKIVAIQAENCAPLVKAYQTGEESAQPVTNKGTLAEGISIAAPARSKQI
LEAVHNTNGTFIDIEEDEILSARAKLSEKGFYVEVTSAVNYAGYIKYKKAPEEKIIIPLC
GGGIKSK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatttatttgtaacagttgtggcaaaaagcatgatattacaccaactctatgg
aaatgtgaatgtggaggagtattaaacatagtaaaagataccccaaaagttgatacctcg
gcttggaataactatccaaactcattatggcgttattttgaaaccatgccattcgcaaaa
gattctaagacatgggaatccgtgacaatgggtgaaggtcaatcacctattatcgttcta
gatcctacggagccaaatacgtatgtaaaagttgattatatgatgcctacattatccttt
aaagatcgaggagccgttgttttgatgacaaaggcaaaagaattaggggtatcaaaagta
attgctgatagtagtggtaatgcaggaacggcgattgcagcttatgcagcacgttgtaat
attgcctgtgatatatatctaagtgatgaaacttcaccgaaaaagatcgctcaaataaaa
gcccatggagcaacgattaaagagattcgtggtacaagagaggacattgcagctgcggca
caaaaagcagtagacgaagaaaaagttttttacgcaagtcatgtgtataatccttatttt
tatgaaggaacgaaaacatatgcctatgaaatttatgaacaattaaatagtgcgcctgat
gctttaattattccggttggaaacggtacgcttctcctaggtgcatattatggctttaaa
gagttatttgaaaatggattaattgataaaataccgaaaatcgttgccattcaagcggag
aactgtgcgcctcttgtgaaagcttaccaaaccggggaggaatcagcacaacctgttaca
aataaaggtactttagcggaagggatatctattgctgcaccagcgcgttccaaacaaatt
ttagaagctgtacataataccaatggtacgtttattgatattgaagaagatgagattctg
agtgcacgagcaaaactgagtgagaaaggattttatgtggaagtgacatcagcagtaaac
tatgctggctacatcaagtataaaaaggcaccagaagaaaaaataatcatacctctttgt
ggtggaggtattaaatcaaaataa

DBGET integrated database retrieval system