KEGG   Bacillus atrophaeus 1942: BATR1942_08350Help
Entry
BATR1942_08350    CDS       T01339                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00020  Citrate cycle (TCA cycle)
bae00310  Lysine degradation
bae01100  Metabolic pathways
bae01110  Biosynthesis of secondary metabolites
bae01120  Microbial metabolism in diverse environments
bae01130  Biosynthesis of antibiotics
bae01200  Carbon metabolism
Module
bae_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bae_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BATR1942_08350
  Amino acid metabolism
   00310 Lysine degradation
    BATR1942_08350
Enzymes [BR:bae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BATR1942_08350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADP32603
UniProt: A0A0H3E2R6
Position
complement(1689347..1690600)
Genome map
AA seq 417 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLQEVLK
DSGDTVQVGEIIGTITEGAGESSAPASEDKAPKSENTKEEKQAEPAAQQVSQEAQEESKS
RTVASPSARKLAREKGIDLSQIPTGDPLGRVRKQDVEAYEKPSAKPAPQPKQQPQAQKSQ
QDFEKPVEVQKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAVMNVRKRRKDQFLEQNE
VKLGFMSFFTKAVVAALKKFPLLNAEIQGDELIIKKFYDVGIAVAANEGLVVPVVRDADR
LSFAGIEREIGELAKKARSNKLTLGELQGGSFTITNGGTFGSLLSTPILNSPQVGILGMH
KIQLRPVAIDEERFENRPMMYIALSYDHRIVDGKEAVGFLVTVKNLLEDPEQLLLEG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaggtacctgaattagcagaatcaatctcagaaggaacaatagcccaa
tggttaaagcagcccggggattatgtagaacagggtgaatatctgcttgaactggaaacg
gataaagtgaatgtggaactgacagctgaagaatcgggtgtacttcaagaggtattgaaa
gattcgggtgataccgtccaagtcggagaaattatcggcacgattacagaaggtgcggga
gaaagttctgcccccgcgtctgaagacaaagctccaaaaagtgaaaatacaaaagaagag
aagcaagctgaaccggctgcacagcaagtcagccaggaagcgcaagaagaatcaaagtcg
agaacagtggcatctccatcagcacgcaagctagcgagagaaaaaggaattgacttgtca
caaattccaacaggggatcctctcggcagagttcgcaaacaagatgtagaagcctatgaa
aaaccatcagcaaaacctgcgcctcagccaaaacagcagccgcaggcacaaaaatcacag
caagactttgaaaagccggttgaagtgcaaaaaatgtcacgccgcagacagaccatcgcc
aaacgtctggtagaggtgcagcagacatctgctatgctgacaacatttaatgaagtagac
atgacagcggttatgaatgtaagaaaacgccgcaaagatcaatttttggagcaaaatgaa
gtaaagcttggctttatgtcattctttacaaaagccgttgtggcggccctgaagaagttc
ccgctattgaatgctgaaattcaaggtgacgaactgatcattaagaaattctatgatgtg
ggtattgcagtagcggcgaacgaaggtcttgttgtacctgttgtccgtgatgctgaccgt
ctttcattcgccggaattgagagagaaatcggtgaacttgcgaaaaaagcgagaagcaac
aaattaacgcttggtgagctgcaaggcggttccttcacgattacaaacggaggaacattc
ggttcattgctatctacgccaatcttaaacagccctcaagttggaattttaggaatgcat
aaaatccagctgcgtcctgttgcaattgacgaagaacgctttgaaaaccgtccgatgatg
tatattgcattatcttatgaccaccggattgtagacggaaaagaagcggtcggattctta
gtgactgtgaaaaacttgctcgaagatcctgaacagcttttattagagggataa

DBGET integrated database retrieval system