KEGG   Bacillus atrophaeus: BATR1942_08350Help
Entry
BATR1942_08350    CDS       T01339                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bae  Bacillus atrophaeus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BATR1942_08350
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BATR1942_08350
  Amino acid metabolism
   00310 Lysine degradation
    BATR1942_08350
Enzymes [BR:bae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BATR1942_08350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1689347..1690600)
Genome map
AA seq 417 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLQEVLK
DSGDTVQVGEIIGTITEGAGESSAPASEDKAPKSENTKEEKQAEPAAQQVSQEAQEESKS
RTVASPSARKLAREKGIDLSQIPTGDPLGRVRKQDVEAYEKPSAKPAPQPKQQPQAQKSQ
QDFEKPVEVQKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAVMNVRKRRKDQFLEQNE
VKLGFMSFFTKAVVAALKKFPLLNAEIQGDELIIKKFYDVGIAVAANEGLVVPVVRDADR
LSFAGIEREIGELAKKARSNKLTLGELQGGSFTITNGGTFGSLLSTPILNSPQVGILGMH
KIQLRPVAIDEERFENRPMMYIALSYDHRIVDGKEAVGFLVTVKNLLEDPEQLLLEG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaggtacctgaattagcagaatcaatctcagaaggaacaatagcccaa
tggttaaagcagcccggggattatgtagaacagggtgaatatctgcttgaactggaaacg
gataaagtgaatgtggaactgacagctgaagaatcgggtgtacttcaagaggtattgaaa
gattcgggtgataccgtccaagtcggagaaattatcggcacgattacagaaggtgcggga
gaaagttctgcccccgcgtctgaagacaaagctccaaaaagtgaaaatacaaaagaagag
aagcaagctgaaccggctgcacagcaagtcagccaggaagcgcaagaagaatcaaagtcg
agaacagtggcatctccatcagcacgcaagctagcgagagaaaaaggaattgacttgtca
caaattccaacaggggatcctctcggcagagttcgcaaacaagatgtagaagcctatgaa
aaaccatcagcaaaacctgcgcctcagccaaaacagcagccgcaggcacaaaaatcacag
caagactttgaaaagccggttgaagtgcaaaaaatgtcacgccgcagacagaccatcgcc
aaacgtctggtagaggtgcagcagacatctgctatgctgacaacatttaatgaagtagac
atgacagcggttatgaatgtaagaaaacgccgcaaagatcaatttttggagcaaaatgaa
gtaaagcttggctttatgtcattctttacaaaagccgttgtggcggccctgaagaagttc
ccgctattgaatgctgaaattcaaggtgacgaactgatcattaagaaattctatgatgtg
ggtattgcagtagcggcgaacgaaggtcttgttgtacctgttgtccgtgatgctgaccgt
ctttcattcgccggaattgagagagaaatcggtgaacttgcgaaaaaagcgagaagcaac
aaattaacgcttggtgagctgcaaggcggttccttcacgattacaaacggaggaacattc
ggttcattgctatctacgccaatcttaaacagccctcaagttggaattttaggaatgcat
aaaatccagctgcgtcctgttgcaattgacgaagaacgctttgaaaaccgtccgatgatg
tatattgcattatcttatgaccaccggattgtagacggaaaagaagcggtcggattctta
gtgactgtgaaaaacttgctcgaagatcctgaacagcttttattagagggataa

DBGET integrated database retrieval system