KEGG   Bacillus atrophaeus: BATR1942_08755Help
Entry
BATR1942_08755    CDS       T01339                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bae  Bacillus atrophaeus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BATR1942_08755
   00670 One carbon pool by folate
    BATR1942_08755
Enzymes [BR:bae01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BATR1942_08755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1755875..1756381)
Genome map
AA seq 168 aa AA seqDB search
MISFIFAMDENRLIGKNNDLPWRLPNDLAYFKKVTTGHTIVMGRKTFESIGRPLPNRKNI
VVTSADKAEFPGCTVVRTIEDVLTTASDAEECFVIGGAQLYQALFPYADRLYMTKIHHTF
DGDRYFPEFNEDEWKLISEEQGTKDEKNPYNYEFLVYEKKNSSEAGGL
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgatttcttttatattcgcgatggatgaaaacaggctgattggaaaaaacaatgatttg
ccgtggcggcttccaaacgatctcgcttattttaaaaaggtgacgacaggccataccatt
gtgatgggccggaaaactttcgagtccattggccgcccgctcccgaatcggaaaaacatc
gtggtgacatcagcagataaagctgaatttccgggctgtacagttgtcagaacaattgaa
gatgttctgacaaccgcctctgatgcagaggagtgctttgttattgggggcgcacagctc
tatcaggctttgttcccttatgctgacaggctgtatatgacaaaaattcaccatacattt
gacggggaccgttatttccctgagtttaatgaagacgaatggaagctcatttctgaagaa
cagggaaccaaagatgaaaaaaacccgtacaattatgagttcctagtatacgaaaaaaag
aattcatctgaagcgggaggactttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system