KEGG   Bacillus atrophaeus: BATR1942_09185Help
Entry
BATR1942_09185    CDS       T01339                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bae  Bacillus atrophaeus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bae01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bae00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bae00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1832139..1832942)
Genome map
AA seq 267 aa AA seqDB search
MFNLIQKLSDKLFIPFITAGDPLPEVSIELAKSLQKAGASALELGVAYSDPLADGPVIQR
ASKRALANEMNILKAIELGGKMKKSGVDIPIILFTYYNPVLQLNKEYFFALLRENHIDGL
LVPDLPFEESAQLQQECKKNNVTYISLVAPTSESRLKKITEQAEGFVYCVSSLGVTGVRN
EFDSAVYSFIRTVKELSSVPVAVGFGISSREQVIKMNEMCDGVVVGSALVRKIEELQNQL
VCQDTRERAVQTFEEYAKTFSGLYSLK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatttgatacagaagctttctgacaaattgtttattcccttcattacggccgga
gaccctttgcccgaggtctctattgagcttgcaaagtcccttcaaaaagcgggagcttcc
gcgctggagctgggtgtcgcctactcagacccgcttgccgacggaccggttatccagcgt
gcttcgaaacgggcgcttgccaatgagatgaatatcttaaaagccatagaattaggcggt
aaaatgaaaaaaagtggtgtcgatattccgataattctctttacgtattataatcctgtg
ttacaattgaacaaagaatactttttcgctttactgcgggaaaatcatatagacggcttg
cttgttccggatttgccatttgaggaaagtgcccagcttcagcaagaatgcaaaaaaaat
aatgtgacctatatttccttggtggcaccgacaagcgaaagtcgtttaaaaaaaatcaca
gaacaggccgagggcttcgtatattgtgtgtcttcattaggcgtgaccggcgttcgcaat
gaattcgactcagcagtctactcctttatccggacggttaaggagctcagctctgttcct
gtggctgtagggttcggaatctccagccgcgaacaggtaatcaagatgaatgagatgtgt
gacggtgtcgttgtaggcagcgcactggtcagaaaaatagaagaattgcaaaaccagctc
gtctgtcaggatacaagggagcgtgcggtgcaaacatttgaagaatatgcgaagacgttt
agtggcttgtacagtttaaaatga

DBGET integrated database retrieval system