KEGG   Bacillus atrophaeus 1942: BATR1942_09185Help
Entry
BATR1942_09185    CDS       T01339                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bae  Bacillus atrophaeus 1942
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BATR1942_09185 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BATR1942_09185 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BATR1942_09185 (trpA)
Enzymes [BR:bae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BATR1942_09185 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1832139..1832942)
Genome map
AA seq 267 aa AA seqDB search
MFNLIQKLSDKLFIPFITAGDPLPEVSIELAKSLQKAGASALELGVAYSDPLADGPVIQR
ASKRALANEMNILKAIELGGKMKKSGVDIPIILFTYYNPVLQLNKEYFFALLRENHIDGL
LVPDLPFEESAQLQQECKKNNVTYISLVAPTSESRLKKITEQAEGFVYCVSSLGVTGVRN
EFDSAVYSFIRTVKELSSVPVAVGFGISSREQVIKMNEMCDGVVVGSALVRKIEELQNQL
VCQDTRERAVQTFEEYAKTFSGLYSLK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatttgatacagaagctttctgacaaattgtttattcccttcattacggccgga
gaccctttgcccgaggtctctattgagcttgcaaagtcccttcaaaaagcgggagcttcc
gcgctggagctgggtgtcgcctactcagacccgcttgccgacggaccggttatccagcgt
gcttcgaaacgggcgcttgccaatgagatgaatatcttaaaagccatagaattaggcggt
aaaatgaaaaaaagtggtgtcgatattccgataattctctttacgtattataatcctgtg
ttacaattgaacaaagaatactttttcgctttactgcgggaaaatcatatagacggcttg
cttgttccggatttgccatttgaggaaagtgcccagcttcagcaagaatgcaaaaaaaat
aatgtgacctatatttccttggtggcaccgacaagcgaaagtcgtttaaaaaaaatcaca
gaacaggccgagggcttcgtatattgtgtgtcttcattaggcgtgaccggcgttcgcaat
gaattcgactcagcagtctactcctttatccggacggttaaggagctcagctctgttcct
gtggctgtagggttcggaatctccagccgcgaacaggtaatcaagatgaatgagatgtgt
gacggtgtcgttgtaggcagcgcactggtcagaaaaatagaagaattgcaaaaccagctc
gtctgtcaggatacaagggagcgtgcggtgcaaacatttgaagaatatgcgaagacgttt
agtggcttgtacagtttaaaatga

DBGET integrated database retrieval system