KEGG   Bacillus atrophaeus 1942: BATR1942_09190Help
Entry
BATR1942_09190    CDS       T01339                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bae  Bacillus atrophaeus 1942
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BATR1942_09190
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BATR1942_09190
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BATR1942_09190
Enzymes [BR:bae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BATR1942_09190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1832935..1834137)
Genome map
AA seq 400 aa AA seqDB search
MYQYPNEIGRFGEFGGKFVPETLMQPLEQIEKAFKEIKNDPVFEAEYKKLLFDYSGRPTA
LTFADQVTNHLGGAKIYLKREDLNHTGSHKINNALGQALLAKKMGKTKIIAETGAGQHGV
AAATVAAKFGFPCTVFMGEEDVARQSLNVFRMKLLGAEVVPVTSGNGTLKDATNEAIRYW
VQHCEDHFYMIGSVVGPHPYPYIVREFQRIIGDEAKEQLRGIEGNLPDKVVACVGGGSNA
IGIFQAFLAENVDLIGAEAAGKGIDTSLHAATISKGTKGVIHGSLTYLIQDQFGQIIEPY
SISAGLDYPGIGPEHAYLHQSGRVKYESVTDDEAVAALRLLSEKEGILPAIESAHALAKA
FEMAKEMDREQSILVCLSGRGDKDVNTLMQVLEDEVNAHV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaatatccaaatgaaatcggcaggtttggcgagtttggcggaaaatttgttcct
gaaacgctgatgcagcctttagaacaaattgaaaaagcattcaaagaaataaagaatgat
cctgttttcgaagcagagtataaaaagctgttattcgactattccggaaggccgacagcg
ctgacatttgccgatcaggtgacaaatcatttaggcggggctaaaatttatttaaaaaga
gaagatttaaaccatacaggttcccacaaaatcaataacgctttgggacaggctctgctt
gcaaaaaaaatgggcaaaacaaaaatcattgctgaaacaggggcaggccagcacggtgtc
gcagcggcgacggtagccgcgaaatttggttttccctgtaccgtttttatgggagaagaa
gatgtggcgcgtcagtcgctgaatgtgttccgtatgaaacttctgggagcggaagtggtt
ccggtcacaagcggaaatggtacgcttaaggacgcaacgaatgaagcgatcagatactgg
gtccagcattgtgaggatcatttttatatgatcggttctgtagtaggtcctcatccgtac
ccttacattgttcgtgaattccaaagaataatcggcgatgaagcgaaagaacagctgcgc
ggcatagaaggaaatcttccggacaaagtggttgcatgtgttggcggaggaagcaatgct
attggtatctttcaggcttttttagcggaaaatgtagatttgataggcgcagaagccgcc
ggaaaaggaattgacacttctcttcacgcagccactatctcaaaaggaacaaaaggtgtc
atccacggatcgctgacttatttgattcaggatcaattcggccagatcatagagccatac
tccatttcggcaggattggactatccgggaatcgggccggagcatgcttatcttcaccaa
agcggccgagtgaagtatgaaagtgtgacggatgatgaagcggtcgctgcattaaggctt
ctctccgaaaaagaaggcattttgccggcaatcgaatctgcccatgcattagctaaggcg
tttgaaatggctaaagaaatggaccgtgagcaaagtatactcgtttgtttgtcaggaaga
ggagacaaagacgtgaacacattgatgcaagtattggaagatgaggtgaatgcacatgtt
taa

DBGET integrated database retrieval system