KEGG   Bacillus atrophaeus 1942: BATR1942_10390Help
Entry
BATR1942_10390    CDS       T01339                                 

Definition
(GenBank) degradative acetoacetyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00071  Fatty acid degradation
bae00072  Synthesis and degradation of ketone bodies
bae00280  Valine, leucine and isoleucine degradation
bae00310  Lysine degradation
bae00362  Benzoate degradation
bae00380  Tryptophan metabolism
bae00620  Pyruvate metabolism
bae00630  Glyoxylate and dicarboxylate metabolism
bae00640  Propanoate metabolism
bae00650  Butanoate metabolism
bae00900  Terpenoid backbone biosynthesis
bae01100  Metabolic pathways
bae01110  Biosynthesis of secondary metabolites
bae01120  Microbial metabolism in diverse environments
bae01130  Biosynthesis of antibiotics
bae01200  Carbon metabolism
bae01212  Fatty acid metabolism
bae02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BATR1942_10390
   00630 Glyoxylate and dicarboxylate metabolism
    BATR1942_10390
   00640 Propanoate metabolism
    BATR1942_10390
   00650 Butanoate metabolism
    BATR1942_10390
  Lipid metabolism
   00071 Fatty acid degradation
    BATR1942_10390
   00072 Synthesis and degradation of ketone bodies
    BATR1942_10390
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BATR1942_10390
   00310 Lysine degradation
    BATR1942_10390
   00380 Tryptophan metabolism
    BATR1942_10390
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BATR1942_10390
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BATR1942_10390
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BATR1942_10390
Enzymes [BR:bae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BATR1942_10390
Exosome [BR:bae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BATR1942_10390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADP33009
UniProt: A0A0H3E5I4
Position
complement(2032655..2033836)
Genome map
AA seq 393 aa AA seqDB search
MTKTVIVSAARTPFGKFGGALKELKAAELGGIAIKEALNRAGINGSQADEVIMGMVVQAG
AGQIPSRQAARLAEVPWEVPTETINKVCASGLRAVTLGDQIIRAQDGDILVAGGMESMSN
IPYAVPAGRWGARMGDAAMQDLMVYDGLTCAFDQVHMAVHGNTAAEEYGITRKEQDEWAL
RSQKRAAHAIDEGKFKEEIVPVAWVDRKGKTKTADTDEGLRRETSLEQLAKLPPIYSKEG
SVTAGNAPGVNDGAGAFVLMSEEKAAELGKKPLATILGFAAVGQEASCLAAAPGLAINKL
LKKTGFSVQDIDLFEVNEAFASVALTCEKIVGWDREKVNVNGGAIALGHPIGASGARILM
TLIYELKRRGGGLGIAAICSGAAQGDAILIRVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaacagtcatcgtgagtgccgcaagaacaccttttggcaaatttggcggagct
ttaaaggagctgaaggctgctgaactcggggggattgccattaaggaagctttgaaccgg
gcgggaatcaatgggagccaagcagacgaagtcattatgggcatggtcgttcaagcaggc
gcaggccaaatcccgtctcgccaggctgcccgtttggcggaggtgccgtgggaggtgccg
actgaaacgattaataaagtatgcgcatcaggtcttcgggcggtcaccttgggggatcaa
atcatcagggctcaagatggggatatccttgtagctggaggaatggaaagcatgagtaat
attccttatgccgttccggcgggacgctggggcgcccgtatgggggatgctgcaatgcag
gatctgatggtttatgacggattaacctgtgcttttgatcaggttcacatggctgttcat
gggaatactgcggctgaagaatatggaattacccgtaaggagcaggatgagtgggctctg
cgcagccagaaaagggctgctcatgcgattgatgaagggaagtttaaagaggaaattgtg
ccggttgcttgggttgaccgaaaagggaagacgaaaacagcggataccgatgaaggtctg
cgccgggagaccagtttagagcagcttgcaaaactgccgccgatttattcgaaggaggga
tcggtcactgccggcaatgcaccgggagtaaatgacggagcgggagcttttgtgctcatg
tcagaagaaaaagccgccgagctcggaaagaaaccgctggcgacgatactcggattcgca
gcagtcggccaggaagcatcatgtcttgctgcggccccggggcttgccatcaataaactg
ctgaaaaaaaccggtttttcggttcaggatatcgacttgtttgaagttaatgaagcattt
gcttctgttgcgttgacatgcgaaaaaatcgtcggatgggaccgtgaaaaggtaaacgtg
aatggcggggccattgctcttggacacccgattggagcaagcggcgcaagaatacttatg
actttgatatacgaattgaagcgaaggggaggcggtttaggtatcgctgccatctgcagc
ggggccgcccaaggtgacgccatattaatccgggtccattga

DBGET integrated database retrieval system