KEGG   Bacillus atrophaeus 1942: BATR1942_10740Help
Entry
BATR1942_10740    CDS       T01339                                 

Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00010  Glycolysis / Gluconeogenesis
bae00052  Galactose metabolism
bae00500  Starch and sucrose metabolism
bae00520  Amino sugar and nucleotide sugar metabolism
bae00521  Streptomycin biosynthesis
bae01100  Metabolic pathways
bae01110  Biosynthesis of secondary metabolites
bae01120  Microbial metabolism in diverse environments
bae01130  Biosynthesis of antibiotics
bae01200  Carbon metabolism
Module
bae_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bae_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BATR1942_10740
   00052 Galactose metabolism
    BATR1942_10740
   00500 Starch and sucrose metabolism
    BATR1942_10740
   00520 Amino sugar and nucleotide sugar metabolism
    BATR1942_10740
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BATR1942_10740
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BATR1942_10740
Enzymes [BR:bae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BATR1942_10740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase FtsA
Motif
Other DBs
NCBI-ProteinID: ADP33079
UniProt: A0A0H3E5P2
Position
complement(2091528..2092493)
Genome map
AA seq 321 aa AA seqDB search
MDEVWFAGIDLGGTTIKLAFINMYGEIQHKWEVPTDKTGDTITVTIAKAIDSKLEEVSKP
KHIVKYIGMGAPGPVDMMTGTVYETVNLGWKNYPLKNHLEAETGIPAVIENDANIAALGE
MWKGAGDGAKDVILVTLGTGVGGGIIANGEIIHGKNGAGGEIGHICCIPEGGAPCNCGKT
GCIETIASATGIVRIAKGKIAEAKQATRLAEQKDLSARDVFEAANANDAAALEVVDEVAN
FLGLVLGNLASSLNPSKIVLGGGVSKAGEILRSKVETAFRQYAFPRAGKAADISIAALGN
DAGVIGGAWIAKNEWLTHQNS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggtatggtttgcgggcattgatttaggaggaactacaattaagcttgcgttt
attaatatgtatggagaaattcagcataaatgggaggtcccgaccgacaaaacgggagat
acaatcacagttacgattgcaaaagcgattgacagcaaattagaggaagtaagcaaaccg
aagcatattgtaaagtacattggaatgggggcgcccggccctgtagacatgatgacgggc
acggtttatgaaaccgtgaacctagggtggaaaaattacccgctgaagaatcatttagag
gcggaaacgggtattcccgccgttattgaaaacgatgccaatattgccgcgctgggtgaa
atgtggaagggcgccggcgacggagcaaaggatgtgattcttgtgacgcttggcaccggc
gtaggcggaggcattatcgctaacggggagatcattcacgggaaaaatggagccggcgga
gaaatcggccatatatgctgtattcctgaaggtggagcgccttgcaattgcggtaaaacg
ggctgtatcgaaaccattgcgtcggcgaccggaatcgtaagaattgcaaaggggaaaatt
gcagaggctaagcaggcgacgcgccttgcagaacagaaggatttatcagcgcgcgatgtg
tttgaagcagcaaatgccaatgatgcagctgcacttgaagtcgttgatgaggtcgctaat
tttctcggccttgtgcttggaaatttggcaagctcactcaatccgtcaaaaatcgttctt
ggcggaggcgtttccaaagcgggagaaatattaagatcaaaagtcgaaacagcgttccgc
caatatgcatttccgcgtgcgggcaaagcggctgacatttcaatcgcggctctcggcaat
gatgccggagtcattggcggagcatggattgccaaaaatgagtggctgacccatcaaaat
agttaa

DBGET integrated database retrieval system