KEGG   Bacillus atrophaeus: BATR1942_10740Help
Entry
BATR1942_10740    CDS       T01339                                 

Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bae  Bacillus atrophaeus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BATR1942_10740
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BATR1942_10740
   00052 Galactose metabolism
    BATR1942_10740
   00500 Starch and sucrose metabolism
    BATR1942_10740
   00520 Amino sugar and nucleotide sugar metabolism
    BATR1942_10740
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BATR1942_10740
   00524 Butirosin and neomycin biosynthesis
    BATR1942_10740
Enzymes [BR:bae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BATR1942_10740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2091528..2092493)
Genome map
AA seq 321 aa AA seqDB search
MDEVWFAGIDLGGTTIKLAFINMYGEIQHKWEVPTDKTGDTITVTIAKAIDSKLEEVSKP
KHIVKYIGMGAPGPVDMMTGTVYETVNLGWKNYPLKNHLEAETGIPAVIENDANIAALGE
MWKGAGDGAKDVILVTLGTGVGGGIIANGEIIHGKNGAGGEIGHICCIPEGGAPCNCGKT
GCIETIASATGIVRIAKGKIAEAKQATRLAEQKDLSARDVFEAANANDAAALEVVDEVAN
FLGLVLGNLASSLNPSKIVLGGGVSKAGEILRSKVETAFRQYAFPRAGKAADISIAALGN
DAGVIGGAWIAKNEWLTHQNS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggtatggtttgcgggcattgatttaggaggaactacaattaagcttgcgttt
attaatatgtatggagaaattcagcataaatgggaggtcccgaccgacaaaacgggagat
acaatcacagttacgattgcaaaagcgattgacagcaaattagaggaagtaagcaaaccg
aagcatattgtaaagtacattggaatgggggcgcccggccctgtagacatgatgacgggc
acggtttatgaaaccgtgaacctagggtggaaaaattacccgctgaagaatcatttagag
gcggaaacgggtattcccgccgttattgaaaacgatgccaatattgccgcgctgggtgaa
atgtggaagggcgccggcgacggagcaaaggatgtgattcttgtgacgcttggcaccggc
gtaggcggaggcattatcgctaacggggagatcattcacgggaaaaatggagccggcgga
gaaatcggccatatatgctgtattcctgaaggtggagcgccttgcaattgcggtaaaacg
ggctgtatcgaaaccattgcgtcggcgaccggaatcgtaagaattgcaaaggggaaaatt
gcagaggctaagcaggcgacgcgccttgcagaacagaaggatttatcagcgcgcgatgtg
tttgaagcagcaaatgccaatgatgcagctgcacttgaagtcgttgatgaggtcgctaat
tttctcggccttgtgcttggaaatttggcaagctcactcaatccgtcaaaaatcgttctt
ggcggaggcgtttccaaagcgggagaaatattaagatcaaaagtcgaaacagcgttccgc
caatatgcatttccgcgtgcgggcaaagcggctgacatttcaatcgcggctctcggcaat
gatgccggagtcattggcggagcatggattgccaaaaatgagtggctgacccatcaaaat
agttaa

DBGET integrated database retrieval system