KEGG   Bacillus atrophaeus: BATR1942_11465Help
Entry
BATR1942_11465    CDS       T01339                                 

Definition
exonuclease
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bae  Bacillus atrophaeus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bae00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BATR1942_11465
Enzymes [BR:bae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BATR1942_11465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2224102..2226495)
Genome map
AA seq 797 aa AA seqDB search
MQQHPDQLKMEEEPFLKGAVTTVIYHNDANLYTVLKVKVTETSEAIEDKVVSVTGYFPAL
QEEETYTFYGKTATHPKFGLQFQAEHFKKEIPTTKEGIIQYLSSDLFEGIGKKTAEEIVK
KLGDSALNRILADSSVLYDVPKLSKKKADTLAGALQRHQGLEQIMISLNQFGFGPQLSMK
IYQAYESETLEKIQENPYQLVKDVEGIGFVKADELGGRMGISGNHPERIKAAILYSIETT
CLSEGHTYIETKQLIIDTQKLLNQSSEGQLVTEMDAANEIIALGENKAIMIEDDRCYFPS
LYYAEQNVAKRVRHIASQTEYEDQFPESEFLLALGDLEERTKVQYAASQKEAIQKALSSP
MLLLTGGPGTGKTTVIRGIVELYSELHGASLDPSDYKKDEVFPFVLAAPTGRAAKRMSES
TGLPAVTIHRLLGWNGAEGFTHTDENPIEGKLLIIDEASMLDIWLANHLFKAIPDHIQII
IVGDEDQLPSVGPGQVLRDLLASQVIPTVRLTDIYRQAEGSSIVELAHDMKKGLLPANLT
APTKDRSFIRCGSLQIKEVVEKVVTNALKKGYTARDIQVLAPMYRGKAGINELNVLLQGI
LNPPKEKRREIKFGDVVYRTGDKILQLVNQPENNVFNGDIGEITSIFYAKENTEKEDMAV
VSFDGNEMTFTKKDFSQFTHAYCCSIHKSQGSEFPIVVLPVVKGYYRMLRRNLLYTAITR
AKKFLILCGEEEALEWGVKNNDATVRQTSLQRRLTLQAEEMDEELKALQKELPFSVYDAN
IGMEGITPFDFMKEKHS
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcagcatccggatcagctgaaaatggaggaagaaccctttttaaaaggtgcggta
accactgtcatttatcataatgatgccaatttatatacagttttgaaagtgaaagtcaca
gagacctccgaagcgattgaagataaagtcgtatccgtgacgggctacttccctgcgctg
caagaagaagagacctacacgttttacggaaaaacagccacccatcctaaattcgggctc
cagtttcaagcggagcactttaaaaaagagatcccgactacgaaggaagggatcatccaa
tacttatcaagtgatctgttcgaaggaatcggaaagaaaacggctgaagaaatcgtcaaa
aaactgggagacagcgctcttaatcgaattctcgctgactcctcagtgctttacgatgtg
ccgaagctgtcaaaaaagaaagctgatacgctggcaggagctcttcagcggcatcagggc
ctggaacaaattatgatctcgctgaaccagttcggattcggtccgcagctttcaatgaaa
atttatcaggcatatgaatcggaaacacttgagaagattcaagaaaatccgtatcagctt
gtgaaagatgtggaaggcatcgggtttgtgaaagccgatgaactcggggggagaatgggg
atttccggcaatcaccctgagcggattaaagcagcgattttgtattccattgaaacgaca
tgtctttcagaagggcatacgtacatagaaacaaagcagcttattattgatacgcaaaag
cttttgaaccaatcatcagaaggacagctggtgacagagatggacgcagcgaatgaaatc
atcgcgcttggcgaaaataaagctatcatgattgaggatgaccgctgttactttccatct
ttatattatgcggaacaaaacgtagccaagcgtgtccggcatatcgcaagccaaactgag
tatgaagaccaatttcctgaatctgagtttttactcgcgctcggtgatctcgaagagcgt
acgaaagttcagtatgcggcaagccaaaaagaagcgattcaaaaagcgctctcgtccccg
atgcttctgttaacgggaggacccggcaccggaaaaaccactgttatcagagggattgtg
gagttatacagtgagcttcacggcgcttcgcttgatccgtccgattataagaaagatgaa
gtttttccgtttgttttggctgcgccgacaggaagagcggcaaaacgaatgagtgagtcg
accggacttccggccgtcacgattcacaggctgcttggctggaacggggctgaagggttt
actcatacagacgaaaatccgattgaaggaaagctgttaattatagacgaagcgagtatg
cttgatatatggctcgcaaaccatttgtttaaagcgatacccgatcatattcaaattatt
atagttggggatgaggaccagcttccttctgtcgggccgggacaggtgctgcgggatctg
ttggcttcacaggtcattccgacagtcaggctgacggatatttaccggcaggcggaaggt
tcatctattgtggagcttgctcatgacatgaaaaaaggcttgcttccggctaacctgaca
gcgccgacgaaggatcgttcctttattcgctgcggctcattacaaatcaaagaagttgtt
gaaaaggtcgtcaccaatgcgctgaaaaaaggctacacagcaagggatatacaggtgctg
gctccgatgtacagaggaaaagcaggcattaatgagcttaatgtgctgctgcagggcatc
ttaaatccgccgaaagaaaaacggcgcgaaattaaattcggcgatgttgtttatagaacc
ggcgataaaattttacagcttgtgaatcagccggaaaataatgtgtttaatggtgatatt
ggtgagattacatccattttctacgcgaaggaaaatacagaaaaagaagatatggcggtt
gtttcctttgacggaaatgaaatgaccttcaccaaaaaagacttcagccagtttacgcac
gcctattgctgctccattcataaatctcaaggcagtgaatttccgatagtcgtgcttccc
gttgtaaaaggctattatcgaatgctgagaagaaatctcctctatacggcaattacaaga
gcgaaaaagtttctcattttatgcggtgaagaggaagcgctggagtggggcgtgaaaaat
aatgatgcgacagtcagacaaacctctttacaaagaaggctgacgctgcaggctgaggaa
atggatgaagaacttaaagctcttcaaaaagagctgccgtttagcgtatacgacgcaaat
atcggcatggaaggcattacaccatttgatttcatgaaagaaaaacatagctaa

DBGET integrated database retrieval system