KEGG   Bacillus atrophaeus: BATR1942_11585Help
Entry
BATR1942_11585    CDS       T01339                                 

Gene name
tgt
Definition
queuine tRNA-ribosyltransferase (EC:2.4.2.29)
Orthology
K00773  
queuine tRNA-ribosyltransferase [EC:2.4.2.29]
Organism
bae  Bacillus atrophaeus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2250867..2252012)
Genome map
AA seq 381 aa AA seqDB search
MAEQPIRYEFIKECKQTGARLGRVHTPHGSFDTPVFMPVGTLATVKTMSPDELKAMDAGI
ILSNTYHLWLRPGHDIVKEAGGLHKFMNWDRAILTDSGGFQVFSLSKFRNIEEEGVHFRN
HLNGDKLFLSPEKAMEIQNALGSDIMMAFDECPPYPAEYDYMKRSVERTSRWAERCLEAH
SRSDEQGLFGIVQGGEYEELRTQSAKDLISLDFPGYAIGGLSVGEPKDVMNRVLEFTTPL
LPKDKPRYLMGVGSPDALIDGALRGVDMFDCVLPTRIARNGTVFTAEGRLNMKNAKFERD
FRPIDEECDCHTCKNYSRAYIRHLIRCNETFGIRLTTYHNLHFLLNLMEQVRQAIREDRL
GDFREEFFERYGYNKPNAKSF
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaacaaccaatacgctatgaatttataaaagaatgcaaacaaacgggagcacgc
ttgggaagagtgcatactccgcacggctcctttgacacacctgtttttatgccggtcggc
acactggcgacagtcaaaacgatgtcgcctgacgagctgaaggcaatggacgcgggaatt
attttgagcaatacctaccatctttggctgagacccggccatgacatcgtcaaggaagcg
ggcggccttcacaaatttatgaactgggaccgtgcaattttaacggattcaggcggtttt
caggtcttttcgttaagtaagtttcgtaatatagaagaggaaggcgttcatttccgtaat
cacttaaacggagataagctgttcctttcacccgaaaaagcaatggaaatccaaaatgcg
ctcggatccgatattatgatggcgtttgatgaatgcccgccatatccggctgaatacgat
tatatgaaacggtctgttgaacggacgagccgttgggcggagcgctgccttgaagcccac
agccgttcagacgaacagggtctgtttggcatcgtacaaggcggagaatatgaagaatta
cggacacaaagcgcgaaggacttgatttctcttgattttccgggctatgctataggcgga
ctgtctgtcggtgaaccgaaagatgtcatgaaccgggtgcttgagttcacaacgcctctt
ttaccgaaagataagccgagatacctgatgggtgtcggatctcctgatgctttgattgac
ggagcgttgcgcggtgttgacatgttcgactgtgtgctgccgacccgtattgcgagaaac
ggaaccgtttttacggctgaagggcgtctcaatatgaaaaatgcaaaattcgaaagagat
ttccgcccgattgatgaagagtgcgattgccatacttgtaaaaattactcacgcgcttac
atcagacatttaattcgctgtaatgaaacattcggtatccgattaacaacttatcataat
cttcattttctgttaaacttaatggagcaagtaagacaggccattcgtgaggatcgcctg
ggtgatttcagagaagagttctttgagcgttacggctataacaagccaaatgcgaaaagc
ttctaa

DBGET integrated database retrieval system