KEGG   Bacillus atrophaeus: BATR1942_11835Help
Entry
BATR1942_11835    CDS       T01339                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bae  Bacillus atrophaeus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BATR1942_11835
Enzymes [BR:bae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BATR1942_11835
Exosome [BR:bae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BATR1942_11835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2301144..2302118)
Genome map
AA seq 324 aa AA seqDB search
MNQTFNRHRRLRANASMRELVKETRLHPSDFIYPIFVVEGLEGKKAVPSMPDVYHVSLDI
LKDEMAELVNLGIKSVIVFGIPEEKDSCGTQAFHDHGIVQKAIAEIKKHFPELVVIADTC
LCEYTDHGHCGLVKEGEILNDESLELLAQTAVSQAKAGADIIAPSNMMDGFVAVIREALD
QEGFVNIPIMSYAVKYSSEFYGPFRDAADSTPQFGDRKTYQMDPANRLEALREAESDVAE
GADFLIVKPSMSYLDIMRDVKNQYNLPLVAYNVSGEYSMVKAAAQNGWIKEKEMVLEILT
SMKRAGADLIMTYHAKDAAKWLAE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaacgtttaacagacaccgccgcttgcgcgcaaacgcaagtatgagagaatta
gtaaaggaaacacgtttgcacccatcggattttatttatccgatttttgtcgtggaaggg
cttgagggaaaaaaagccgtcccttcaatgccggacgtttatcatgtatcattagatata
ctgaaggacgaaatggctgagcttgtcaatctcggcattaagtctgtcatcgtattcgga
atcccggaagaaaaagacagctgcggcactcaggctttccatgatcacggaattgtgcaa
aaagccattgccgaaatcaaaaagcattttcctgagcttgtcgtcattgctgatacttgt
ttatgtgagtatacggaccacgggcattgcggccttgtcaaagagggggaaattctgaat
gatgaatcgcttgagctgttagcgcaaaccgcggtaagccaagctaaagcgggtgcggat
attattgcgccatcaaacatgatggacggctttgtcgcagttatcagagaagcgctcgat
caagaaggattcgtcaatattccgatcatgtcttatgctgtaaaatattcaagtgaattt
tacggcccgttccgtgatgcggctgacagcacaccgcaatttggcgaccgtaaaacgtat
caaatggatcctgccaaccgtctggaagcgcttcgtgaagcggaatcagacgttgccgaa
ggcgcagactttttaatcgtcaagccgtctatgtcttatttagacatcatgcgtgacgtg
aaaaatcaatataacctgccgcttgtggcttataatgtaagcggggagtattcgatggtg
aaggctgcggcacaaaacggctggatcaaagaaaaagaaatggtgttagaaattttaaca
agcatgaagcgtgcaggcgcggaccttattatgacgtaccatgcaaaagacgcagccaaa
tggcttgcggagtaa

DBGET integrated database retrieval system