KEGG   Bacillus atrophaeus: BATR1942_11840Help
Entry
BATR1942_11840    CDS       T01339                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bae  Bacillus atrophaeus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bae00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2302115..2302906)
Genome map
AA seq 263 aa AA seqDB search
MRSDDLPLEGKTVLVTRNKAQAASFQQKVEALGGSAVSASLITFQKALPNEYANKLQKDL
SEPGWLVFTSVNGAQFFFSYLKENRLPHPAQKKIAAVGEKTARYLQTRHVTVDVMPDTYI
AECLADTLKKHALISDRVTVIKGNLSRGVIKTELEPLGFQVREWVLYNTIPDEQGIAELR
QASGRSSFDYITFTSSSSVHTFMHALGNGERVWENDRTNYISIGPLTQEALMQYGISSHI
PETFTVEGMLTLMCSMSRKEGLR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcggagtgatgatcttcctttagaaggaaagaccgtgcttgtcacccgcaacaaagcg
caggcggcttcgtttcaacagaaagtggaggcgctcggcggatcggctgtttcagcttcg
cttattacatttcagaaagctttacccaatgaatatgcaaacaagcttcaaaaggatctt
tctgaaccgggatggcttgtctttaccagtgtaaatggcgctcaattctttttttcctac
ctgaaggaaaacagactgcctcatccggcgcagaaaaagattgccgctgtcggagagaag
acggccaggtacttgcaaacccgtcatgtaacggtggatgtaatgccggatacatatatt
gcggagtgcttggctgacacattaaagaagcatgcattaataagtgatcgggtcacggtc
ataaaaggcaatttatcacggggtgtgataaaaacagagctggagcctcttggctttcag
gtcagagaatgggtgttgtacaataccattcccgatgaacaaggcatagctgagctgaga
caggcttctggccgttcttcatttgattatattacatttacaagctcatcctctgtgcat
acatttatgcacgcgctgggaaatggagaaagagtctgggagaatgacaggacgaattat
atcagcatcggccctttaacacaggaggcactgatgcagtacggcatttcgtctcatatc
cccgagacattcacggtagaaggaatgctgacattgatgtgcagcatgtcaagaaaggaa
ggattaagatga

DBGET integrated database retrieval system