KEGG   Bacillus atrophaeus: BATR1942_12380Help
Entry
BATR1942_12380    CDS       T01339                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bae  Bacillus atrophaeus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BATR1942_12380
   01230 Biosynthesis of amino acids
    BATR1942_12380
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BATR1942_12380
   00030 Pentose phosphate pathway
    BATR1942_12380
   00051 Fructose and mannose metabolism
    BATR1942_12380
   00052 Galactose metabolism
    BATR1942_12380
  Energy metabolism
   00680 Methane metabolism
    BATR1942_12380
Enzymes [BR:bae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BATR1942_12380
Protein phosphatases and associated proteins [BR:bae01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BATR1942_12380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2418315..2419274)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYSGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMSEILARLKRGHDRGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSASDRVLASRLGAYAVELLLEGKGGRCVGIQNNKLVDHDIIEIL
DKKHTVEQNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtataggagttttaacgagtggcggggattccccgggaatgaacgcagcagtg
cgcgcggttgtcagaaaagcaatttatcatgacgtggaagtttacggcatttataacggc
tactcaggattaatcagcggaaaaattgaaaagcttgaattgggctcagtcggtgatatt
attcatcgaggcggaacgaagctttatacggcaagatgtcctgaattcaaaacagttgag
ggccgtgaaaaaggaattgaaaacttaaagaagcttggcattgaagggcttgttgtcatc
ggcggcgacggttcctacatgggtgcgaaaaaattaacggaacacgggtttccttgtgta
ggtgtaccgggtactattgataatgatatcccgggaactgattttacaatcggttttgac
acggccttaaatacagtcattgatgcaattgataagatccgcgataccgcgacatcacat
gaacgtacatatgttatagaagtgatgggacggcatgcaggcgatatcgctttgtgggca
ggtcttgccggcggtgcagaatccattttgattcctgaagcggattatgacatgtctgag
atccttgccagactgaaaagaggacatgaccgcggtaagaaacacagcatcatcattgtt
gccgagggagtcggcagcggagtcgaatttgggaaacgcattgaagaagaaacaaatctt
gaaaccagggtatcagttttggggcatatccaacgcgggggatcgccgagcgcatctgac
cgtgtgcttgcaagccgcctgggcgcatatgctgtcgagcttcttcttgaaggcaaaggc
ggacgttgtgtaggtatacaaaacaataagcttgtagaccatgatattatagaaatattg
gataaaaaacatacagttgaacaaaacatgtatcaactttcaaaagaactgtctatctaa

DBGET integrated database retrieval system