KEGG   Bacillus atrophaeus 1942: BATR1942_12515Help
Entry
BATR1942_12515    CDS       T01339                                 

Definition
(GenBank) putative acyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00010  Glycolysis / Gluconeogenesis
bae00620  Pyruvate metabolism
bae00640  Propanoate metabolism
bae00680  Methane metabolism
bae01100  Metabolic pathways
bae01110  Biosynthesis of secondary metabolites
bae01120  Microbial metabolism in diverse environments
bae01130  Biosynthesis of antibiotics
bae01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BATR1942_12515
   00620 Pyruvate metabolism
    BATR1942_12515
   00640 Propanoate metabolism
    BATR1942_12515
  Energy metabolism
   00680 Methane metabolism
    BATR1942_12515
Enzymes [BR:bae01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BATR1942_12515
Lipid biosynthesis proteins [BR:bae01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BATR1942_12515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADP33434
UniProt: A0A0H3E6T6
Position
complement(2444315..2445910)
Genome map
AA seq 531 aa AA seqDB search
MLKREDLIAPMNYNLVNEIEKFSRSGQKTALLWEDESGKQASWSYEKLMEETDKIGAALT
GLGFEKGDKLIVMVPRVLEAYAVYLAILKAGMVVIPCSEMLRAKDLEYRIAHAEVKGAIV
YPQFISAFKDVKSTDKLITLSIGENEAGWKDLLSIQADGSSFKTADTTREDMAFLSYTSG
TTGQPKGVVHTHGWAFAHLKTSAGEWLGISENDNVWATAAPGWQKWVWSPLLAVLGSGAT
GFVYHGRFGAEKYLELLSRYQINVFCCTPTEYRLMAKVEGLETYDLSALHSAVSAGEPLN
REVIDVFQKYFGVKVRDGYGQTESTLLVGVLKDMDIKPGSMGKPTPGNQVEIINEDGGIC
KTGETGDIAVHLSTPALFKEYYKDPERTKKQVRGDYFLTGDRAKKDEDGYFWFESRNDDI
IVSSGYTIGPFEVEDALVKHPEVRECAVVASPDEIRGSIVKAYVVLQNHEKRSDDLVKTL
QNHVKTITAPYKYPREIEFVESLPKTASAKIRRVELRKREEQLKANKKAQS
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaaacgagaagatttaattgccccaatgaactataacttagtaaatgaaattgaa
aagttcagccgttctggacagaaaaccgccctgttatgggaggacgaatcaggaaaacaa
gcttcatggtcatatgaaaagctaatggaagaaaccgataaaatcggtgccgcgctgaca
ggtttaggattcgaaaaaggcgataagctgattgtcatggttccgagagtgctagaagct
tatgccgtttatttggccatcctgaaagcgggaatggtcgttattccttgctcggaaatg
cttcgggcgaaagaccttgaatatcggattgcgcacgcagaagtaaagggcgccattgtt
tatccgcaatttatcagcgcatttaaagatgtcaagtcgactgacaaattaatcacgctg
tcaataggagaaaatgaggctggatggaaagacctgttaagcattcaggctgatggaagc
agttttaaaacagcagatacaactagagaggatatggcgttcttatcctatacatccggg
acgaccggtcagccgaagggcgttgtacatacacatggctgggcatttgcccatttaaaa
acatccgccggcgagtggctcggcatttccgaaaacgacaacgtatgggcgacagcagcg
ccaggctggcaaaaatgggtatggagccctctgcttgcggtactgggaagcggagcgacc
ggatttgtgtaccacggaagatttggcgccgagaaatatttggagctattaagccgttat
caaatcaatgtattctgctgcacgccgacagagtacaggctgatggcaaaagtggaaggc
ttggaaacctatgacctttctgccctgcacagcgcagtatcggcgggagagccgttaaac
cgggaagtcattgatgttttccaaaaatacttcggagtgaaagtcagagacggatatggc
caaacggaaagcacgcttttagtcggtgtgctgaaagatatggatataaagccgggaagc
atgggaaaaccgacacccggaaatcaggttgaaatcataaatgaagacggcggcatctgc
aaaacgggtgaaacgggggatattgccgtacatctaagcacaccggcgctttttaaagaa
tattataaagaccctgaacgaacgaaaaagcaagtgcgcggcgactatttcctcacggga
gacagagcgaaaaaagacgaggacggctacttctggtttgaaagccgaaacgatgacatc
attgtaagctccggctatacgatcgggccttttgaagtcgaagacgcgcttgtcaaacac
ccggaagttagagagtgcgcagtagtggcgagccccgatgaaatcagaggctcaatcgta
aaagcgtatgtcgtgctgcaaaatcacgaaaagcgcagcgatgatcttgtcaaaacgctt
caaaatcacgttaaaacgatcacagctccatacaaatatcctagagaaatagaatttgtc
gaaagcctgccaaaaacagcttccgccaaaatcagacgtgtcgagctaagaaaacgtgaa
gaacagcttaaagccaataaaaaggcgcagtcgtaa

DBGET integrated database retrieval system