KEGG   Bacillus atrophaeus: BATR1942_12795Help
Entry
BATR1942_12795    CDS       T01339                                 

Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bae  Bacillus atrophaeus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bae01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bae00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2500251..2501642)
Genome map
AA seq 463 aa AA seqDB search
MNWEVEVIRKKEDLIRDTQQFLQINSVMDEQTAAAGMPFGKGVNECLTSLLSLGEKEGFT
TKNVDGYAGHIEWGQGEEIVGVLCHVDVVPPGDGWTSDPFSADIRDGRIYARGAIDDKGP
TMAAFYALKIVKDMQLPLSKRVRIIIGTDEESDWRCVEHYFKHEDMPTVGFAPDADFPII
NAEKGIIDASLRILPPTLDSSAESVLASFQSGLRLNMVPDAAEAVIEGSGQEDILKSFEQ
MLKDTDGKGEVSVEENRVVLRMFGQSCHAMEPNNGVNAGIKLAEFLQRIELDEAGRHFIH
AITESFSNDTRGKKLNIACEDKISGELTLNVGTFRYEKAKGGELGINIRYPVTAGSQTIR
EAFENNGTFQLGEFKDSKPHHVSADHPLVKTLQAVYEGQVGQKADLISIGGGTYARSLQA
GVAFGPLFPGRPDSAHQKDEYIEIDDLLRATALYAQAIYELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaagtcgaagttattaggaaaaaagaggatttaataagggatacgcagcaa
tttttacaaatcaacagtgtgatggatgaacaaacagccgccgcaggtatgccatttgga
aaaggggtaaatgaatgcctcacttcattgctttcgcttggtgagaaagaggggttcacg
actaaaaatgttgatgggtacgccggacatattgaatgggggcaaggcgaggagatcgtc
ggcgttctctgccatgttgacgtcgtgccgcccggagacggctggacaagcgatcccttt
tccgccgatatccgggacgggcgtatctatgcgagaggcgcaatagatgataaagggccg
acaatggccgcgttctacgctttaaagattgtcaaggatatgcagctcccgctgtctaag
cgcgtcagaatcatcatcggaacggatgaagaaagcgattggcgctgtgtggagcattat
tttaagcacgaggatatgccgactgtcggctttgcgcctgatgccgattttcctattatt
aatgccgaaaaaggaattattgatgcgtctttacgtattttgccgcctactcttgattca
tctgcggaatcggtgcttgcttcttttcaatcaggccttcgtttaaatatggtgcctgac
gcagcagaagctgtgatcgaaggatccggacaagaggacattctcaaatcttttgagcaa
atgctgaaggatactgatggcaaaggtgaagtgtctgttgaggaaaaccgggtggtcttg
cgcatgtttggtcaatcctgccacgcaatggagccgaataacggtgtgaatgccggaatt
aagctggctgaatttttacagcgtattgagcttgatgaggcagggcgccattttatccat
gctataacggagtcattctccaacgatacgcggggtaaaaagctgaacatagcctgtgag
gataaaattagcggcgaactgacgttaaatgtcggaacgttccgttatgaaaaagcaaag
ggcggggaacttggcatcaatatccgatatcctgtaacggcaggaagccagacaataaga
gaagcttttgaaaacaacggtacattccagcttggagaatttaaagatagcaagccgcat
catgtatcagcggatcatccattagtaaaaacccttcaggctgtgtatgaaggccaagtg
ggacaaaaagcggacttaatttcaatcggcggaggtacgtacgccagatccttgcaggcg
ggtgttgctttcgggcctttgttcccggggcgtcccgacagcgctcatcaaaaggatgaa
tacattgaaattgatgatttgctgagagcaacggctttatatgcgcaggccatttacgaa
ttggcaaaataa

DBGET integrated database retrieval system