KEGG   Bacillus atrophaeus: BATR1942_12795Help
Entry
BATR1942_12795    CDS       T01339                                 

Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bae  Bacillus atrophaeus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BATR1942_12795
  Amino acid metabolism
   00300 Lysine biosynthesis
    BATR1942_12795
Enzymes [BR:bae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BATR1942_12795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2500251..2501642)
Genome map
AA seq 463 aa AA seqDB search
MNWEVEVIRKKEDLIRDTQQFLQINSVMDEQTAAAGMPFGKGVNECLTSLLSLGEKEGFT
TKNVDGYAGHIEWGQGEEIVGVLCHVDVVPPGDGWTSDPFSADIRDGRIYARGAIDDKGP
TMAAFYALKIVKDMQLPLSKRVRIIIGTDEESDWRCVEHYFKHEDMPTVGFAPDADFPII
NAEKGIIDASLRILPPTLDSSAESVLASFQSGLRLNMVPDAAEAVIEGSGQEDILKSFEQ
MLKDTDGKGEVSVEENRVVLRMFGQSCHAMEPNNGVNAGIKLAEFLQRIELDEAGRHFIH
AITESFSNDTRGKKLNIACEDKISGELTLNVGTFRYEKAKGGELGINIRYPVTAGSQTIR
EAFENNGTFQLGEFKDSKPHHVSADHPLVKTLQAVYEGQVGQKADLISIGGGTYARSLQA
GVAFGPLFPGRPDSAHQKDEYIEIDDLLRATALYAQAIYELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaagtcgaagttattaggaaaaaagaggatttaataagggatacgcagcaa
tttttacaaatcaacagtgtgatggatgaacaaacagccgccgcaggtatgccatttgga
aaaggggtaaatgaatgcctcacttcattgctttcgcttggtgagaaagaggggttcacg
actaaaaatgttgatgggtacgccggacatattgaatgggggcaaggcgaggagatcgtc
ggcgttctctgccatgttgacgtcgtgccgcccggagacggctggacaagcgatcccttt
tccgccgatatccgggacgggcgtatctatgcgagaggcgcaatagatgataaagggccg
acaatggccgcgttctacgctttaaagattgtcaaggatatgcagctcccgctgtctaag
cgcgtcagaatcatcatcggaacggatgaagaaagcgattggcgctgtgtggagcattat
tttaagcacgaggatatgccgactgtcggctttgcgcctgatgccgattttcctattatt
aatgccgaaaaaggaattattgatgcgtctttacgtattttgccgcctactcttgattca
tctgcggaatcggtgcttgcttcttttcaatcaggccttcgtttaaatatggtgcctgac
gcagcagaagctgtgatcgaaggatccggacaagaggacattctcaaatcttttgagcaa
atgctgaaggatactgatggcaaaggtgaagtgtctgttgaggaaaaccgggtggtcttg
cgcatgtttggtcaatcctgccacgcaatggagccgaataacggtgtgaatgccggaatt
aagctggctgaatttttacagcgtattgagcttgatgaggcagggcgccattttatccat
gctataacggagtcattctccaacgatacgcggggtaaaaagctgaacatagcctgtgag
gataaaattagcggcgaactgacgttaaatgtcggaacgttccgttatgaaaaagcaaag
ggcggggaacttggcatcaatatccgatatcctgtaacggcaggaagccagacaataaga
gaagcttttgaaaacaacggtacattccagcttggagaatttaaagatagcaagccgcat
catgtatcagcggatcatccattagtaaaaacccttcaggctgtgtatgaaggccaagtg
ggacaaaaagcggacttaatttcaatcggcggaggtacgtacgccagatccttgcaggcg
ggtgttgctttcgggcctttgttcccggggcgtcccgacagcgctcatcaaaaggatgaa
tacattgaaattgatgatttgctgagagcaacggctttatatgcgcaggccatttacgaa
ttggcaaaataa

DBGET integrated database retrieval system