KEGG   Bacillus atrophaeus 1942: BATR1942_12795Help
Entry
BATR1942_12795    CDS       T01339                                 

Definition
(GenBank) dipeptidase PepV
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00300  Lysine biosynthesis
bae01100  Metabolic pathways
bae01120  Microbial metabolism in diverse environments
bae01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BATR1942_12795
Enzymes [BR:bae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BATR1942_12795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADP33488
UniProt: A0A0H3E557
Position
complement(2500251..2501642)
Genome map
AA seq 463 aa AA seqDB search
MNWEVEVIRKKEDLIRDTQQFLQINSVMDEQTAAAGMPFGKGVNECLTSLLSLGEKEGFT
TKNVDGYAGHIEWGQGEEIVGVLCHVDVVPPGDGWTSDPFSADIRDGRIYARGAIDDKGP
TMAAFYALKIVKDMQLPLSKRVRIIIGTDEESDWRCVEHYFKHEDMPTVGFAPDADFPII
NAEKGIIDASLRILPPTLDSSAESVLASFQSGLRLNMVPDAAEAVIEGSGQEDILKSFEQ
MLKDTDGKGEVSVEENRVVLRMFGQSCHAMEPNNGVNAGIKLAEFLQRIELDEAGRHFIH
AITESFSNDTRGKKLNIACEDKISGELTLNVGTFRYEKAKGGELGINIRYPVTAGSQTIR
EAFENNGTFQLGEFKDSKPHHVSADHPLVKTLQAVYEGQVGQKADLISIGGGTYARSLQA
GVAFGPLFPGRPDSAHQKDEYIEIDDLLRATALYAQAIYELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaagtcgaagttattaggaaaaaagaggatttaataagggatacgcagcaa
tttttacaaatcaacagtgtgatggatgaacaaacagccgccgcaggtatgccatttgga
aaaggggtaaatgaatgcctcacttcattgctttcgcttggtgagaaagaggggttcacg
actaaaaatgttgatgggtacgccggacatattgaatgggggcaaggcgaggagatcgtc
ggcgttctctgccatgttgacgtcgtgccgcccggagacggctggacaagcgatcccttt
tccgccgatatccgggacgggcgtatctatgcgagaggcgcaatagatgataaagggccg
acaatggccgcgttctacgctttaaagattgtcaaggatatgcagctcccgctgtctaag
cgcgtcagaatcatcatcggaacggatgaagaaagcgattggcgctgtgtggagcattat
tttaagcacgaggatatgccgactgtcggctttgcgcctgatgccgattttcctattatt
aatgccgaaaaaggaattattgatgcgtctttacgtattttgccgcctactcttgattca
tctgcggaatcggtgcttgcttcttttcaatcaggccttcgtttaaatatggtgcctgac
gcagcagaagctgtgatcgaaggatccggacaagaggacattctcaaatcttttgagcaa
atgctgaaggatactgatggcaaaggtgaagtgtctgttgaggaaaaccgggtggtcttg
cgcatgtttggtcaatcctgccacgcaatggagccgaataacggtgtgaatgccggaatt
aagctggctgaatttttacagcgtattgagcttgatgaggcagggcgccattttatccat
gctataacggagtcattctccaacgatacgcggggtaaaaagctgaacatagcctgtgag
gataaaattagcggcgaactgacgttaaatgtcggaacgttccgttatgaaaaagcaaag
ggcggggaacttggcatcaatatccgatatcctgtaacggcaggaagccagacaataaga
gaagcttttgaaaacaacggtacattccagcttggagaatttaaagatagcaagccgcat
catgtatcagcggatcatccattagtaaaaacccttcaggctgtgtatgaaggccaagtg
ggacaaaaagcggacttaatttcaatcggcggaggtacgtacgccagatccttgcaggcg
ggtgttgctttcgggcctttgttcccggggcgtcccgacagcgctcatcaaaaggatgaa
tacattgaaattgatgatttgctgagagcaacggctttatatgcgcaggccatttacgaa
ttggcaaaataa

DBGET integrated database retrieval system