KEGG   Bacillus atrophaeus: BATR1942_13040Help
Entry
BATR1942_13040    CDS       T01339                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bae  Bacillus atrophaeus
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BATR1942_13040
Enzymes [BR:bae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BATR1942_13040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2551944..2552723)
Genome map
AA seq 259 aa AA seqDB search
MWTWKADRPVGSIVIIHGASEYHGRYKWLIEMWRSSGYNVVMGDLPGQGTTTRARGHIRS
FQEYIDEVDKWIDTARTFELPVFLLGHSMGGLISIEWFKQQRNPRITALILSSPCLGLQI
KVNKVLDIASRGLNVIAPSFKVDSGLSLDMATRNQSVIEADQNDSLYVTKVSVRWYRELL
KTFESAMVPTDAFLKVPLLVMQAGDDRLVDKSKVIKWFSGVASHNKSYREWEGLYHEIFN
EPEREAVFKAARAFTDQYI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtggacctggaaagcagacagacctgtgggttcaattgttatcatccacggggcaagc
gaataccacggacgatataaatggttaatagaaatgtggagatcttcaggctataacgtt
gtgatgggcgatttgccggggcagggaacaaccacccgggcgagaggtcatattcgatca
tttcaagaatacattgatgaagtagataaatggatagatacagccagaacctttgaattg
cctgttttccttctcggtcacagtatgggcgggttaatttcgattgaatggtttaaacag
cagagaaatccccgcattacggcacttattttatcatcaccctgtctcggtctgcaaatt
aaagtaaacaaagtgcttgatatcgcatcgagggggctgaatgtcatcgcgccgtcgttt
aaggtggactcaggtttgtcacttgatatggccacacgtaatcagtccgtaatagaggct
gatcaaaatgattctttatatgtcacaaaagtgtctgtcagatggtacagggagctgtta
aaaacatttgagtccgccatggtgccgactgatgcttttctgaaggtgccgcttctcgtc
atgcaggcaggagacgacaggcttgtggacaaaagtaaggtaatcaaatggttttcagga
gtagcgtcccacaataagtcatacagagaatgggaaggcctctatcatgaaatattcaat
gaaccagaaagagaagctgttttcaaagcagcaagagcatttaccgatcagtatatttga

DBGET integrated database retrieval system