KEGG   Bacillus atrophaeus: BATR1942_13295Help
Entry
BATR1942_13295    CDS       T01339                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bae  Bacillus atrophaeus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BATR1942_13295
Enzymes [BR:bae01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BATR1942_13295
Exosome [BR:bae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BATR1942_13295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2598691..2600571)
Genome map
AA seq 626 aa AA seqDB search
MTDASPTAHDVYLFHEGCLFQSYQLFGAHYQELNGEKGFRFCVWAPHALDVRVAGDFNNW
SGKLHAMDKVNDQGIWSLFISDLAEGERYKYEIMTESGDIQLKSDPYAFYSEVRPNTASI
TYDLTGYTWHDQKWMKKLKAKPIYEKPVFIYELHLGSWKKHSDGRLYSYQELTDSLIPYV
KEHGFTHIELMPVIEHPYDRSWGYQGTGYFSPTSRFGTPHDLMNFIDQCHQQHIGVILDW
VPGHFCKDSHGLYMFDGKPVYEYQEAHDRENWVWGTANFDLGKSEVHSFLISNALYWAEI
YHIDGFRVDAVANLLYWPNQEERHENPYAIGFLKKLNQKMNEAYPHVLMIAEDSTDWPDV
TRPAQEGGLGFHFKWNMGWMNDILKYMEAPPGQRKSLHQLVSFSLLYAFREHYILPFSHD
EVVYGKKSLLNKMPGDYWQKFAQYRLLLGYFTAHPGKKLLFMGGEFAQFDEWKDTEQLDW
FLDTFPMHQKARVFTQDLLRFYQISKILYENDHRGSSFEWIDVHNDEQSIFSFIRYGKRS
GEALIIVCNFTPEVYHQFDVGVPFYTDYIEVLNSDNKRYGGSGQINGKPLQSRKGTLHHK
PCYVTMTVPPYGISIMRAVKRRGEIK
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgccagcccaacagcacatgatgtttatctttttcatgaaggctgtctgttt
caaagctatcaactgtttggtgcgcattatcaagagctgaatggagaaaaaggatttaga
ttttgtgtttgggcgcctcatgcgttggatgtacgagtggctggcgattttaataactgg
tcaggtaagctacatgccatggacaaagtaaatgatcagggaatttggagtttgtttatt
tcagatctggcagagggagagcgatataagtatgaaatcatgacagagagcggagatatt
caactaaaatcagatccatacgctttctattctgaagtcaggcccaataccgcctccatt
acttatgatctaacaggctatacatggcatgatcagaaatggatgaagaagctgaaagca
aagcccatttatgagaaaccagtctttatatatgagctacatcttgggtcgtggaaaaaa
cactccgacggaaggctctattcttatcaagaattaactgattctcttatcccttatgta
aaagaacacggttttacccatatcgagcttatgccggtaattgagcatccgtatgaccgc
tcttggggttatcagggaaccggatatttcagtccgacaagccggttcggcacaccgcat
gatttgatgaattttatagaccaatgccaccagcaacatataggcgtgattctggattgg
gtgccgggccacttttgtaaggattcacatggactctatatgtttgacggaaagccggtt
tatgaatatcaagaagcgcatgacagagagaactgggtttggggcaccgctaattttgat
ttagggaaatccgaagttcatagttttttaatatctaatgcgttgtactgggcggaaatc
tatcatatagatggattcagggtcgatgctgtggcgaacctgctgtattggccaaatcag
gaggagcgtcatgaaaacccatatgccataggatttttaaaaaagctgaatcaaaagatg
aatgaggcttacccgcatgtgttgatgattgcggaggattctacagattggcctgatgta
acacgtcctgcgcaggaggggggacttggctttcattttaagtggaacatgggatggatg
aacgatatattgaaatatatggaggcgccgcctggccaaaggaaaagcctgcatcagctt
gtttcgttttctttgctttacgccttcagggagcattatattttaccgttttctcacgat
gaagtggtttacggaaagaagtctcttctaaacaaaatgcccggtgattattggcaaaaa
tttgcccaatatcggctgcttctcggctatttcacagcccatcccggaaaaaagctatta
tttatgggcggtgaatttgcccaattcgatgaatggaaagatacagagcagctagattgg
tttttagacaccttccccatgcatcaaaaagccagagtatttacccaagatcttcttcgc
ttttatcaaataagtaaaatcctttacgaaaatgaccatcgtggctcatcttttgaatgg
attgatgttcataatgatgaacaatcaatcttttcttttattcggtacggcaaacggagt
ggtgaggcactaattattgtttgtaattttactcctgaggtctatcatcagtttgatgta
ggcgttcctttttataccgattacatcgaagtattgaacagtgacaataagaggtacgga
ggttccggccaaatcaatggaaagcccttgcagtcgaggaaaggaactctgcatcataag
ccttgttatgtaacaatgaccgtccccccttacggtatttctatcatgcgggccgtaaaa
agaagaggagagatcaagtga

DBGET integrated database retrieval system