KEGG   Bacillus atrophaeus: BATR1942_14350Help
Entry
BATR1942_14350    CDS       T01339                                 

Definition
oxidoreductase involved in fatty acid degradation
Orthology
K00318  
proline dehydrogenase [EC:1.5.-.-]
Organism
bae  Bacillus atrophaeus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BATR1942_14350
Enzymes [BR:bae01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.-  Acting on the CH-NH group of donors
    1.5.-.-  
     BATR1942_14350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2809796..2810704)
Genome map
AA seq 302 aa AA seqDB search
MLRSLFLFLSKNRTLTKLAKTYGIRLGAGRFVAGDTIASAVKTVKRLNRAGLSATIDYLG
EYARTEQEAKKTAAQCKQVIGAIAEHQLDSELSLKLTSIGLDISEELAVSHLKAILKEAK
HHEVAVTIDMEDYSRYERTLRIYKRLKPEFEKLGTVIQAYLYRAAEDIRNLHPLKPNLRL
VKGAYKESAAVAFPDKKGTDLHLQNLIKLQLLSGNYTAVATHDDAIIAFTRKLVSKHRIP
NSQFEFQMLYGIRPERQKELAKEGYRMRVYVPYGTDWYSYFMRRIAERPANAAFVLKGII
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgaagcctgtttttgtttttatctaaaaacagaaccctgaccaagctcgccaag
acatacggcattcgtttaggagctggaagatttgttgcgggcgacacaattgcttctgcg
gtgaaaacggtcaagaggctgaaccgggcgggtctttccgctacaattgattatctgggc
gaatatgcgcgcaccgaacaagaagcaaaaaaaaccgcggcgcaatgtaagcaggtgatc
ggggcaatcgcggaacatcagctggactctgagctgtctctaaagcttacttcaatcgga
ctggatatctcggaagaactagccgtatcccatttgaaggcgattttaaaagaagccaaa
caccacgaagtcgccgtaacaattgatatggaagattactcacgctatgagcggacgctt
cggatttacaaacggctgaagccggagtttgaaaagctgggaaccgtcatccaggcatac
ctgtaccgcgccgcagaggatattaggaacttgcatccccttaagccgaacctcaggctg
gtgaaaggagcgtataaagaatctgccgcggtggcgtttccggataagaaaggaaccgac
cttcatctgcaaaacttgattaagcttcaactgttaagcggaaactataccgccgttgcg
acccatgacgatgccatcattgcatttacgagaaagctcgtttcaaagcaccgcattccg
aacagccaatttgagtttcaaatgctgtacggaatcaggccggagcggcagaaggagctt
gcgaaggaaggataccgcatgcgggtatacgtcccgtacggtacggattggtacagctat
tttatgagaaggattgcagaaagaccggccaatgcggcttttgtgttaaagggaatcatc
aaaaaataa

DBGET integrated database retrieval system