KEGG   Bacillus atrophaeus: BATR1942_14775Help
Entry
BATR1942_14775    CDS       T01339                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bae  Bacillus atrophaeus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2894318..2895058)
Genome map
AA seq 246 aa AA seqDB search
MKVVTPKPFTFKGGDKAVLLLHGFTGNTADVRMLGRYLNERGYTCHAPQYDGHGVPPEEL
VHTGPENWWKNVMDGYEYLKSEGYESIAACGLSLGGVFSLKLGYTVPIKGIVPMCAPMHI
KSEEVMYQGVLSYARNYKKFEGKKPDQIELEMKEFEKTPMNTLQALQELIADVRKNVDMI
YSPTFVVQARHDHMINTESANIIYNEVETDDKQLKWYENSGHVITLDKERDIVHQDVYEF
LEKLNW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgtgacaccaaaaccatttacatttaaaggcggagacaaagcggtgcttttg
ctgcatggctttacagggaatacggcggatgtcagaatgcttggccgttatctcaatgaa
aggggctatacatgccacgcccctcaatatgacggacacggcgttcctcccgaagaactg
gtccatacaggtcctgaaaactggtggaagaatgtcatggacggatatgaatatttgaaa
tcggaaggatatgaaagcattgccgcttgcgggctgtcgcttggaggggttttttcgctg
aaattgggttacactgtacccataaagggaattgttcctatgtgcgcgccaatgcatatt
aagagtgaggaagtcatgtatcaaggagtcctttcgtacgcgcgcaattataaaaaattt
gaaggaaaaaaaccggaccaaattgagctggaaatgaaagaattcgaaaaaacgccaatg
aatacgctgcaagcgctgcaagaactgattgccgatgtgcgtaaaaatgtcgatatgatt
tattctcctacctttgttgttcaggcacggcatgaccatatgattaatactgaaagtgcc
aatatcatttacaacgaggttgaaacagacgataagcagctgaaatggtacgaaaattcc
ggccatgtgattactctggataaagaacgggatatcgtgcatcaagacgtgtatgaattt
ttagaaaagctgaattggtaa

DBGET integrated database retrieval system