KEGG   Bacillus atrophaeus: BATR1942_15865Help
Entry
BATR1942_15865    CDS       T01339                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bae  Bacillus atrophaeus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BATR1942_15865
Enzymes [BR:bae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BATR1942_15865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3117280..3118161
Genome map
AA seq 293 aa AA seqDB search
MSNICVIGSCSMDLVVTSDKRPKAGETVLGTSFQTVPGGKGANQAVAASRLGARVTMVGK
VGDDHYGKAIIDNLKANGVSTEYMEPVIHKDSGTAHIVLAEGDNSIVVVKGANDEITPEY
AKQALEQIEKIDIVLIQQEIPELTVDEVCSYCRSHDIPIMLNPAPARPLKQETIDYASFL
TPNEHEAAILFPGMTASEALTQYPAKLFITEGKQGVRYSDGSKERLIPSFPVEAVDTTGA
GDTFNAAFAVALAEGKEIDDALRFANRAASISVCKFGAQGGMPAREEVEELLS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatatttgcgtaatcggcagctgttcgatggacttagtcgtcacatcggataaa
cgcccgaaagcaggagaaaccgtgcttggcacctcattccaaacagtgcccggcggcaag
ggagcgaatcaggctgtcgcggcttcaagactcggcgcccgcgtcacaatggtcggtaag
gtcggagacgatcactacggtaaagcaatcattgataatctgaaagcaaacggtgtcagc
accgaatatatggaaccggttatacataaagacagcggaacagctcacatcgtgcttgca
gaaggcgataacagcattgtagttgtgaaaggcgccaatgatgagatcacacctgagtat
gccaaacaggcacttgaacaaattgaaaaaatcgacatcgtgctcattcagcaggaaatt
cctgaattaacggtagatgaggtttgcagctattgccgctcacacgatattccgatcatg
ctgaatccggctcctgcccgtccgcttaaacaggaaacgatcgattatgcttcatttctt
acgccaaatgaacatgaagcggccattttgtttcccggcatgacagcctctgaagcactc
acacaatatccggctaagctgtttattacagaaggcaaacaaggcgtccgctactcagac
ggcagcaaagaacggctcatcccttccttccctgttgaagcggttgacacaacgggcgcg
ggagataccttcaacgctgcatttgccgtcgctcttgcggaaggtaaagaaattgacgac
gctctgcgattcgccaatcgcgctgcatccatttccgtctgtaaattcggcgctcagggc
gggatgccagcaagggaagaagtcgaggagctgctgtcatga

DBGET integrated database retrieval system