KEGG   Bacillus atrophaeus: BATR1942_16510Help
Entry
BATR1942_16510    CDS       T01339                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bae  Bacillus atrophaeus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BATR1942_16510
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BATR1942_16510
Enzymes [BR:bae01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BATR1942_16510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3227964..3229253)
Genome map
AA seq 429 aa AA seqDB search
MEKLNIAGGDSLNGTVHISGAKNSAVALIPATILANSEVTIEGLPEISDIETLRDLLKEI
GGSVHFENGEMVVDPTSMISMPLPNGKVKKLRASYYLMGAMLGRFKQAVIGLPGGCHLGP
RPIDQHIKGFEALGAEVTNEQGAIYLRAEKLRGARIYLDVVSVGATINIMLAAVLAEGKT
LIENAAKEPEIIDVATLLTSMGAKIKGAGTNVIRIDGVKELHGCKHTIIPDRIEAGTFMI
AGASMGKEVIIDNVIPTHLESLTAKLREMGFHIETSDDQILIVGGQKELKPVDVKTLVYP
GFPTDLQQPMTSLLTKARGTSVVTDTIYSARFKHIDELRRMGANMKVEGRSAIITGPVEL
QGAKVKASDLRAGACLVVAGLMADGVTEITGLEHLDRGYSDLEKKLEGLGATIWRERLTD
EEIEQLQNS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagttgaatattgccggcggcgactcgttaaatggaacagtacatataagcggc
gcaaaaaacagcgctgtcgctttgatacctgcaaccatcttggcaaattccgaagtgacc
atagaagggcttccggagatttcagatattgaaacgctgcgtgatctgttaaaagaaatc
ggcggcagcgtccattttgaaaatggagaaatggttgttgaccccacttcgatgatcagc
atgccgctccctaacggaaaagtgaaaaaactgcgcgcctcgtattatttaatgggtgcg
atgctcggacgcttcaaacaagcggtgattggtctgccgggaggctgccatctaggtccg
aggccgattgaccagcatataaaaggctttgaagcgcttggagccgaagtgacaaatgaa
cagggcgcgatttatctgcgtgctgaaaagctgagaggcgcccggatctacctggatgtc
gtcagtgtgggggctaccattaatattatgcttgccgccgtgctcgctgaaggaaaaaca
ttgatagaaaacgcggcgaaggagcctgagattatagatgtcgccacactcctgaccagc
atgggcgcaaaaattaaaggcgccggaaccaatgtcatacggatagacggcgtaaaagag
cttcatggctgcaaacatacgattatcccagacagaatagaagccggaacatttatgatc
gccggtgcgtcaatgggcaaggaagtcattatcgacaatgtgattccgactcatcttgaa
tccttaacggcaaagctgagagaaatgggttttcatattgaaacaagcgacgaccaaata
ttgattgtcggcggccaaaaagaattaaagcctgtagatgtgaaaacacttgtatacccg
ggatttccgacagacctgcagcagccgatgacatcgcttttgacaaaggcgagagggaca
agtgtcgtgacggacaccatttactcggcaaggttcaagcatattgacgagctgagacga
atgggagccaatatgaaggtggaaggaagatccgccattattaccggtcctgtcgagctg
caaggcgccaaagtcaaggcaagtgatttgagggcgggcgcctgtcttgtcgtcgccggg
ctgatggccgacggtgtgacggaaattaccggtttagagcatttggacagaggctacagc
gatctggaaaagaaactggaaggtcttggagccacaatctggcgggaaaggctgacagac
gaagagatagaacagttgcaaaattcttag

DBGET integrated database retrieval system