KEGG   Bacillus atrophaeus 1942: BATR1942_16820Help
Entry
BATR1942_16820    CDS       T01339                                 

Definition
(GenBank) nucleotide sugar epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00521  Streptomycin biosynthesis
bae00523  Polyketide sugar unit biosynthesis
bae01130  Biosynthesis of antibiotics
Module
bae_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BATR1942_16820
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BATR1942_16820
Enzymes [BR:bae01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BATR1942_16820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Cupin_2
Motif
Other DBs
NCBI-ProteinID: ADP34283
UniProt: A0A0H3E7H6
Position
complement(3291831..3292286)
Genome map
AA seq 151 aa AA seqDB search
MIKGVKVKKLTKHSDDRGFFAELVRDDENLLEHFGQASWSKSYPGVIKAFHYHEKQDDLW
FFPTGHAQVVLYDLRDDSETKGETDVYFMGEDNPMLLLIPKGVAHGYRVLGETPLTIIYF
TTTSYNPDQPDEKRIPWNDETIGFNWNTTFR
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
gtgattaaaggagtcaaagtcaaaaagctgacgaagcatagtgatgacagaggttttttc
gccgagcttgttcgggatgacgagaatcttcttgaacattttgggcaggcctcatggtca
aaaagctatccaggcgtaattaaagcgtttcattatcatgaaaagcaggatgatctctgg
tttttcccgacaggccacgcccaggttgtcctttatgacctgcgtgacgattctgaaacg
aaaggagaaacggatgtctactttatgggagaagacaatccgatgcttctgttgattcca
aaaggagtcgcccacggttatagggtgcttggagaaacaccgctgacgattatctatttc
actacaacctcgtataaccctgatcagcccgatgaaaaaagaatcccttggaatgacgag
acaatcggttttaactggaacacaacttttcgataa

DBGET integrated database retrieval system