KEGG   Bacillus atrophaeus: BATR1942_16820Help
Entry
BATR1942_16820    CDS       T01339                                 

Definition
nucleotide sugar epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bae  Bacillus atrophaeus
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BATR1942_16820
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BATR1942_16820
Enzymes [BR:bae01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BATR1942_16820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3291831..3292286)
Genome map
AA seq 151 aa AA seqDB search
MIKGVKVKKLTKHSDDRGFFAELVRDDENLLEHFGQASWSKSYPGVIKAFHYHEKQDDLW
FFPTGHAQVVLYDLRDDSETKGETDVYFMGEDNPMLLLIPKGVAHGYRVLGETPLTIIYF
TTTSYNPDQPDEKRIPWNDETIGFNWNTTFR
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
gtgattaaaggagtcaaagtcaaaaagctgacgaagcatagtgatgacagaggttttttc
gccgagcttgttcgggatgacgagaatcttcttgaacattttgggcaggcctcatggtca
aaaagctatccaggcgtaattaaagcgtttcattatcatgaaaagcaggatgatctctgg
tttttcccgacaggccacgcccaggttgtcctttatgacctgcgtgacgattctgaaacg
aaaggagaaacggatgtctactttatgggagaagacaatccgatgcttctgttgattcca
aaaggagtcgcccacggttatagggtgcttggagaaacaccgctgacgattatctatttc
actacaacctcgtataaccctgatcagcccgatgaaaaaagaatcccttggaatgacgag
acaatcggttttaactggaacacaacttttcgataa

DBGET integrated database retrieval system