KEGG   Bacillus atrophaeus: BATR1942_18065Help
Entry
BATR1942_18065    CDS       T01339                                 

Definition
fructose-1,6-bisphosphatase class 3
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bae  Bacillus atrophaeus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BATR1942_18065
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BATR1942_18065
   00030 Pentose phosphate pathway
    BATR1942_18065
   00051 Fructose and mannose metabolism
    BATR1942_18065
  Energy metabolism
   00680 Methane metabolism
    BATR1942_18065
Enzymes [BR:bae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BATR1942_18065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3527237..3529162
Genome map
AA seq 641 aa AA seqDB search
MESKYLDLLAQKYDCEEKVVTEIINLKAILNLPKGTEHFVSDLHGEYQAFQHVLRNGSGR
VKEKIRDIFSGVIYDREIDELAALVYYPEDKLKLIKHDFDAKAALNEWYKETINRMIKLV
SYCSSKYTRSKLRKALPAQFAYITEELLYKTEESANKEQYYSEIADQIIALGQADKLITG
LAYSIQRLVVDHLHVVGDIYDRGPQPDQIMEELINYHSVDIQWGNHDVLWIGAYSGSKVC
LANIIRICARYDNLDIIEDVYGINLRPLLNLAEKYYDDNPSFRPKADENRPEAEIKQITK
IHQAIAMIQFKLESPIIKRRPNFNMEERLVLEKIDYDKNEITLHGKTYQLENTCFATINP
EQPDQLLEEEAEVIDKLLFSVQHSEKLGRHMNFMMKKGSLYLKYNGNLLIHGCIPVDENG
NMETMMIEDKPYAGRELLDVFERFLREAFAHPEETDDLATDMAWYLWTGEYSSLFGKRAM
TTFERYFIKEKETHKEKKNPYYYLREDEATCRNILAEFGLNPDHGHIINGHTPVKEIEGE
DPIKANGKMIVIDGGFSKAYQSTTGIAGYTLLYNSYGMQLVAHKHFNSKAEVLSTGTDVL
TVKRLVDKELERKKVKETNVGEELLQEVAILESLREYRYMK
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagcaagtacctagatttactcgcacaaaaatacgattgtgaagaaaaagtggta
acggaaatcattaatttaaaagcgatactgaacctgccaaaaggcactgagcattttgtc
agtgatttgcacggggagtaccaggcattccagcacgtgctgcgtaatggttcaggacga
gtaaaagagaagatacgcgatattttcagcggtgtcatctatgatagagaaattgatgaa
ttagcagcattggtctattatccggaagacaaactgaagttaatcaaacatgactttgat
gcgaaagcagcattaaacgagtggtataaagaaacaattaacagaatgattaagctcgtt
tcttattgctcctccaagtatacccgctccaaattacgcaaagcactgcctgctcagttt
gcttatattactgaggagctgttatacaaaacagaagaatccgccaacaaggaacaatat
tactctgaaatcgcagatcagatcattgcacttggccaggccgataagctgatcaccggt
cttgcttacagtattcagcgattggtggtcgaccatctgcatgtggtcggcgatatttac
gaccgcggaccgcagccggatcagattatggaagaactgatcaactatcattctgtggat
attcagtggggaaatcacgatgtcctttggataggcgcctattccggttccaaagtatgc
ctggccaatattatccgtatctgtgcccgttatgacaacttggatattattgaagacgtg
tacggcatcaatttgagaccgctgcttaaccttgccgaaaaatattatgatgataatcca
tctttccgtccaaaagcagacgaaaacagaccagaagctgagattaaacaaatcacaaaa
attcatcaagcgattgcgatgattcagttcaagcttgagagtccgattatcaagagacgg
ccgaactttaatatggaggaacggctggtactggaaaagattgattacgataaaaatgaa
atcacgctgcatggaaaaacatatcaactggaaaacacctgctttgcgactatcaatccg
gaacagccagatcagctattagaagaagaagcagaagtcatagacaagctgctattctct
gtccagcattccgaaaagctgggccgccatatgaattttatgatgaaaaaaggcagcctt
tatttaaaatataacggcaacctgttaatccatggctgtattcctgtcgatgaaaacggc
aatatggaaacaatgatgattgaggataaaccgtatgcgggccgtgagctgctcgatgtc
tttgaacgattcttacgagaagcgtttgcccacccggaagaaaccgatgacctggcgaca
gatatggcatggtatttatggacaggcgagtactcctccctcttcggaaaacgcgctatg
acgacatttgagcggtatttcattaaagaaaaagaaacacataaagagaagaaaaacccg
tattactatttacgtgaggacgaggcaacctgccgaaacatcctggcagaattcggcctc
aatccagatcatggccatatcatcaacggccacacacccgtaaaagaaatcgaaggagaa
gatccaatcaaagcaaacggaaaaatgatcgtcatcgacggcggcttctccaaagcctac
caatccacaacaggcatcgccggctacacgctgctatacaactcctacggcatgcagctc
gtcgcccataaacacttcaactccaaggcagaagtcctaagcaccggaaccgatgtctta
acagtgaaacgattagtggacaaagagcttgagcggaagaaagtaaaggaaacgaatgtg
ggtgaggaactgctgcaggaagttgctattttggagagtttgcgggagtatcggtatatg
aagtga

DBGET integrated database retrieval system