KEGG   Bacillus atrophaeus 1942: BATR1942_18215Help
Entry
BATR1942_18215    CDS       T01339                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00220  Arginine biosynthesis
bae00330  Arginine and proline metabolism
bae01100  Metabolic pathways
bae01110  Biosynthesis of secondary metabolites
bae01130  Biosynthesis of antibiotics
bae01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BATR1942_18215
   00330 Arginine and proline metabolism
    BATR1942_18215
Enzymes [BR:bae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BATR1942_18215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase SHOCT
Motif
Other DBs
NCBI-ProteinID: ADP34560
UniProt: A0A0H3E991
Position
complement(3551717..3552607)
Genome map
AA seq 296 aa AA seqDB search
MNKQISIIGMPMDLGQARRGVDMGPSAIRYAHLIERLSEMGYSVEDLGDIPINRENIKND
QELKNLHSVLAGNEKLAQMVNNVIEEQKFPMVLGGDHSIAIGTLAGTAKHYDKLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGIGHESLVNLEGYAPKIKPENVVIIGARSLDEGER
KYIKESGMKVYTMHEIDRLGMTKVIEETLDYLSDCDGVHLSLDLDGLDPSDAPGVGTPVV
GGISYRESHLAMEMLYDAGIITSAEFVEVNPILDHKNKTGNAAVELAESLLGKKLL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaataagcaaatttcaattattggaatgccaatggatttaggacaagcacgacgcgga
gttgacatggggccgagtgcgatacgatatgcccatcttatcgaacggttatcagaaatg
ggttattcggttgaagacctcggcgacatcccgatcaaccgcgaaaatattaaaaatgac
caagaactgaaaaatttacattccgtactggcgggaaatgaaaagcttgcccaaatggtt
aacaatgtcattgaagaacaaaaatttccgatggtcctaggcggcgatcacagcatcgcc
atcggcacgctggccggtacggcaaagcattacgataagctcggcgtcatttggtatgac
gcacacggcgatttgaatacgcttgaaacatcaccatcaggcaatattcacgggatgccg
cttgccgtcagccttggcatcggccatgagtcattggtgaatctggaaggctacgcgccg
aagatcaaaccggaaaacgtcgtcattatcggagcccgttcactagatgaaggagagcgc
aagtatatcaaggaaagcggtatgaaggtatacaccatgcatgaaatcgaccgccttggc
atgacaaaggtcatcgaagaaacccttgattacctgtcagactgtgacggcgtccacctc
agccttgatttagacggactcgatccaagcgatgcgccgggtgttggcacccctgtcgtc
ggcggcatcagctacagagagagccacctggccatggaaatgctgtatgatgcggggatc
attacttccgctgaatttgtagaagtgaatccgatcctggatcacaaaaacaaaaccgga
aatgcagcagttgagcttgctgaatcattgctgggcaaaaaattgctataa

DBGET integrated database retrieval system