KEGG   Bacillus atrophaeus: BATR1942_18715Help
Entry
BATR1942_18715    CDS       T01339                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bae  Bacillus atrophaeus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bae00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BATR1942_18715 (recR)
DNA repair and recombination proteins [BR:bae03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BATR1942_18715 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3657407..3658003
Genome map
AA seq 198 aa AA seqDB search
MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLGMKEDVVLDFAKALVNAKRNLTYCSIC
GHITDQDPCYICEDTRRDKSIICVVQDPKDVIAMEKMKEYNGQYHVLHGAISPMDGIGPE
DIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPSGIKLSRIAHGLPVGGDL
EYADEVTLSKALEGRREM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatcctgaaccaatatcaaagctgattgacagctttatgaaattgccagggatc
ggaccgaaaacagcggttcgtctggctttttttgttctaggtatgaaagaagacgtggta
ttagactttgcaaaggcgcttgttaatgccaagcgaaacctgacatattgttcgatctgc
ggacatattacagatcaggacccttgttatatatgtgaagatacaagacgggacaaatca
atcatttgtgtagtacaggacccgaaagatgtaatcgctatggagaaaatgaaagaatac
aacggacagtatcacgttctccatggcgccatctctccaatggacggcatcggacccgag
gatattaaaataccagaattactaaaacggctgcaggatgatcaagtgacagaggtaatt
cttgctacaaaccctaatatagaaggggaagcaacagcgatgtatatatcaaggctgtta
aagccatctggtattaagctctcccgtattgcccacggactgcctgtcggcggtgatttg
gaatatgctgatgaggtcacgctttctaaagcgcttgaaggaagacgtgaaatgtaa

DBGET integrated database retrieval system