KEGG   Borrelia afzelii (FLI): BAPKO_0055Help
Entry
BAPKO_0055        CDS       T00383                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
baf  Borrelia afzelii (FLI)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:baf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAPKO_0055
   01230 Biosynthesis of amino acids
    BAPKO_0055
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAPKO_0055
   00051 Fructose and mannose metabolism
    BAPKO_0055
   00562 Inositol phosphate metabolism
    BAPKO_0055
Enzymes [BR:baf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BAPKO_0055
Exosome [BR:baf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BAPKO_0055
  Exosomal proteins of bladder cancer cells
   BAPKO_0055
  Exosomal proteins of melanoma cells
   BAPKO_0055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(50231..50992)
Genome map
AA seq 253 aa AA seqDB search
MRKTFLAGNWKMHYTSAEASIVAKQIATEVKTLNDDFVIMITPPFTALSKVSECIKGSNI
LLGAQNMSYMESGARTSEISPSMLLEFGVEYVILGHSECRLYLAETDEIINKKIRAGLKH
SFKYLILCVGETLDERDSGKTLDVVLSQVKKGLDCVSESDIKRIILAYEPVWAIGTGKTA
TKEEAEEVHKAIRLEIMKLYSKSASDNIIIQYGGSVNASNIKELMNEPNIDGALIGGASL
KAESFLSIINNVR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaaacttttttagcgggaaattggaaaatgcattatacaagtgcagaagcttct
attgttgcaaaacaaattgcaactgaagttaaaactttaaatgatgattttgtaataatg
ataactcctccatttacggctttgtctaaggtttcagaatgtattaagggtagtaatatt
cttcttggtgctcaaaacatgtcttatatggaaagtggagcaagaacaagcgagatttcg
ccttcaatgcttttagaatttggagtagaatatgttatacttggtcattctgaatgtaga
ttatatttagcagaaacagacgaaataataaataaaaagattcgtgcggggcttaagcat
tcttttaagtatttaattctttgtgttggagaaactcttgatgagagagattctggaaaa
actttagatgttgttttgagtcaggttaaaaaggggttagattgtgtttctgagtcagat
attaagagaataattttagcttatgaacctgtttgggcaattggaacgggtaaaactgca
actaaagaggaagcagaagaagttcataaggcaattagacttgagattatgaagctttat
tcaaaatcagcttcagataatattataattcagtatggaggctctgttaatgctagcaat
ataaaagagcttatgaatgagcccaatatcgatggtgctttaataggtggagcatctttg
aaggctgaatcttttttatctataatcaataacgttcgttag

DBGET integrated database retrieval system