KEGG   Borrelia afzelii (FLI): BAPKO_0425Help
Entry
BAPKO_0425        CDS       T00383                                 

Gene name
fruA-1
Definition
PTS system, fructose-specific IIABC component
Orthology
K02768  
PTS system, fructose-specific IIA component [EC:2.7.1.69]
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.69]
K02770  
PTS system, fructose-specific IIC component
Organism
baf  Borrelia afzelii (FLI)
Pathway
Fructose and mannose metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Brite
KEGG Orthology (KO) [BR:baf00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BAPKO_0425 (fruA-1)
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    BAPKO_0425 (fruA-1)
Enzymes [BR:baf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.69  protein-Npi-phosphohistidine---sugar phosphotransferase
     BAPKO_0425 (fruA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(421697..423574)
Genome map
AA seq 625 aa AA seqDB search
MFFNFLKKDLVFVLPEVNSKEDVIDFLVEKINDKGYIDSKKEFLQGILDREKIGDTSWEN
GVAIPHFIGDVVKTSFISLLYIKGDGVKWSEENPPVNLIFLICMSKKQQGNEHLKAIAFI
AKLFEDDAFQNALSGIVTADDIYYYIENVQRKAKEEDFRATKAEKIVAVTACPVGVAHTY
IAAKKIENEAKKQGYDIRVETQGSIGIENALTEEEIRDAAIVILAVDKDVDEKRFEGKRV
YKVSTVKAINNTENIIKEAFNAPVFFFKDAGANGSSKGPIATGKGSFYKYLMSGVSPMIP
VVATGGILIALSIAFVGIGPDGPNFSEHPFYKQIADIGSVAFGMMLPVLAGFISMAIADK
PGLAPGLVGGVISGNVKAGFLGAIFAGFLAGYVAKFLAKRSVPEWLRPVMPIFVIPLIST
IIVGFFMLYVGVYIGEFMGVLESGLKSLQSNSETFGVLGKIFLGLVLGSMITVDMGGPFN
KVAFLFGVGLIPQVPEIMGMVAAAIPVPPMAMGLATFLAPKLFENEEKESGKIAFLISFI
GISEGAIPFAASDPGRVIPSIVVGGAVSSIIAAFLGVANHAPHGGPIVLPVVDNKFEFII
AIAVGVAVATALVIFLKSLKSKESE
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgttttttaattttttgaaaaaagatcttgtatttgttttgccagaagtaaattcaaaa
gaagatgtaattgattttttagttgaaaaaatcaatgataagggatatatagatagtaaa
aaagagtttcttcaaggaattcttgatagagagaaaataggcgatacttcttgggaaaat
ggggttgcaattcctcattttataggagatgttgttaaaaccagttttatttcattgctt
tacattaaaggtgatggggttaagtggtctgaagaaaatccccctgttaatttaatattt
ttgatttgtatgtcaaaaaagcaacagggcaatgagcatcttaaggcgattgcatttata
gctaagctgtttgaagatgatgcttttcaaaatgctttaagtgggattgttactgctgat
gacatttattattatatagaaaatgttcagagaaaagccaaagaagaggattttagagcc
acaaaggcagaaaaaatagtagctgtaactgcttgtcctgttggagttgctcatacatat
attgcagcaaagaaaattgaaaatgaagctaaaaagcaggggtacgatattagagttgaa
acccaaggatctattggtattgaaaatgccttaacagaagaagaaattagggatgcagct
attgtaatacttgctgttgataaggatgttgacgaaaagagatttgaaggtaagagagtt
tataaagtctcaactgtaaaagcgataaataatacggaaaatattattaaggaagcgttt
aatgccccagtattttttttcaaagatgctggggctaatggtagttctaaaggcccgatt
gcaacaggtaaagggagcttttataaatatttaatgagcggagtatctccaatgattcct
gttgttgcaactggaggaattttaattgctcttagcattgcttttgttgggatagggccg
gatgggcctaatttttctgagcatccattttataagcagattgcagatattggttctgtg
gcttttggaatgatgctacccgtgcttgctggttttatttcaatggcaattgctgataag
cctggtcttgctcccggtcttgttggtggagtaatatctggaaatgtaaaagcagggttt
ttgggcgcaatatttgcagggtttcttgcaggctatgttgcaaagtttttagcaaagaga
tctgttcctgagtggttaaggcctgtgatgcctatatttgtgattccactaataagcact
attattgttggcttttttatgttgtatgttggtgtttatattggagaatttatgggggtg
cttgagagtgggcttaaatctttacagagcaattcagaaacgtttggtgtgttgggtaaa
attttcttaggtttagtgttggggtcaatgattactgttgatatgggtgggccttttaat
aaagtggcatttctatttggtgtagggttaattcctcaagttccagaaataatgggaatg
gtggcagcagcaattcctgttcctcctatggctatggggcttgcaacttttttagcgcct
aaattatttgaaaatgaagagaaagaatctggcaaaatagcctttttaatttcatttatt
ggtattagtgaaggggctattccttttgctgctagtgatcctggaagggtaattccttca
atagtggtaggaggcgctgtatcaagcattattgctgcttttttaggcgttgcaaatcat
gctccacacggagggccaatagtgcttcctgttgttgataataaatttgagtttattatt
gcaattgctgttggagttgcagttgcaacggctttggtaatttttttgaaatctttaaaa
tcaaaggaatctgaatga

DBGET integrated database retrieval system