KEGG   Borrelia afzelii (FLI): BAPKO_0431Help
Entry
BAPKO_0431        CDS       T00383                                 

Gene name
cheB-1
Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
baf  Borrelia afzelii (FLI)
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:baf02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:baf02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
427773..428900
Genome map
AA seq 375 aa AA seqDB search
METKISVLIIEYFAVKRKLISDLINSSPKLQVIATASNGKFATNKLKKHNPEVILMNLEE
NNIKDILFLEKKNNINKTIPIVVTSSNQNLINIAALKGADDFILVSKNKKSHENQKEQII
NSLLAYGSISIKNKIVRNKDIKIKNNERADFFLNHKNDTFSLPQLEEHAKEKILNEKEIK
KLRLRKFDIIAIGVSAGGPVALKSILPEIPESFPPIIIVQHMPQGFTEEFAKNLNNLCKI
RVKETTNKETLKQGHAYISSGGYHTKIKKIDGNYQVQTFDGKHINGHKPSIGVLFQSIAD
IAKDKAIALIMTGMGNDGSKEIGDIKKAGGLTIAQDKESSMVFGMPKIAIKENNIDYIVP
LNHMVKLLKAILINS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaaaaatttctgtacttatcatagaatactttgctgtaaagagaaagcttata
tcagaccttattaattcatctcccaagctccaagtcattgcaaccgcttctaatggtaaa
ttcgcaacaaataaactcaaaaaacataaccctgaagtaatattaatgaatttagaagaa
aacaacattaaagatattctctttttggagaaaaaaaacaatataaacaaaacaatacca
attgtcgtcacatcttcaaatcaaaacctaataaatattgctgctttaaagggcgctgat
gattttatattagtatctaaaaataaaaaatcacatgaaaaccaaaaagaacaaattatc
aattctcttttagcctatggatcgatatctataaaaaacaaaattgtccgcaacaaggat
ataaaaataaaaaacaatgaaagagctgatttttttttaaatcataaaaatgatactttt
tcattacctcaacttgaagaacatgcaaaagaaaaaatattaaatgaaaaagaaataaaa
aaacttagactgagaaaatttgacataatagccattggagtatcagcaggaggccctgtg
gccttaaaatcaatattgccagaaatacctgaaagctttccaccaataataattgttcaa
catatgcctcaaggatttacagaagaatttgcaaaaaatcttaataatctttgtaaaata
agagtaaaagaaactaccaataaagaaacattaaaacaaggacatgcatacataagctcg
ggcggatatcatacaaaaatcaaaaaaatcgatggcaactatcaagtacaaaccttcgat
ggcaaacatataaatggccacaaaccatctattggggtattatttcaatctattgcagat
attgcaaaagataaagcaattgccctaataatgactggaatgggaaatgatggatcaaaa
gaaattggcgatataaaaaaagccgggggactgactattgcacaagataaagaaagttca
atggtttttggaatgccaaaaatagcaataaaagaaaacaatatagactatatagttcca
ctaaaccatatggtaaaattattaaaagctatactaattaatagctaa

DBGET integrated database retrieval system